KEGG   Paenibacillus lentus: EIM92_10610Help
Entry
EIM92_10610       CDS       T05914                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
plen  Paenibacillus lentus
Brite
KEGG Orthology (KO) [BR:plen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plen03016]
    EIM92_10610
Enzymes [BR:plen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     EIM92_10610
Transfer RNA biogenesis [BR:plen03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    EIM92_10610
 Prokaryotic Type
    EIM92_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase tRNA_int_endo
Motif
Other DBs
NCBI-ProteinID: AZK46547
UniProt: A0A3S8RUX9
LinkDB All DBs
Position
2356365..2356829
Genome map
AA seq 154 aa AA seqDB search
MRVVVQRCKEAKVTVGDSVIGQIGPGLMLLVGITHEDTEKEAAYLADKIAGLRIFEDDEG
KMNRSVADIGGAILSVSQFTLYGDCRKGKRPSFIAAARPDVAEPLYERFNQLLRDKGLVV
ETGKFGADMDVQLTNWGPVTLMLESHQSSMAETL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgttgtgcagcgctgcaaggaggcaaaggttacggtgggggattccgtaatc
ggccaaattggtcctggcttaatgctgctcgttggcattacgcatgaggatacggagaaa
gaggcggcgtacctggcggataaaatcgccggactgcggatatttgaagatgatgaaggc
aagatgaatcgcagtgtagcagacattggtggagctatattgtcggtgtctcagtttacc
ttgtatggggattgccgcaagggcaagcgaccgagtttcatcgctgcagcaagaccggat
gtagctgagccgctatacgagcgttttaatcaattgcttcgcgataaaggcttggtggtc
gaaacgggcaaattcggcgcagatatggacgtgcagctaacgaattggggtcctgtaact
ttaatgctggagagccatcagtcatcaatggcggaaacgctgtag

DBGET integrated database retrieval system