KEGG   Paenibacillus lentus: EIM92_15565Help
Entry
EIM92_15565       CDS       T05914                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
plen  Paenibacillus lentus
Pathway
plen00010  Glycolysis / Gluconeogenesis
plen00020  Citrate cycle (TCA cycle)
plen00620  Pyruvate metabolism
plen01100  Metabolic pathways
plen01110  Biosynthesis of secondary metabolites
plen01120  Microbial metabolism in diverse environments
plen01130  Biosynthesis of antibiotics
plen01200  Carbon metabolism
Module
plen_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:plen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EIM92_15565
   00020 Citrate cycle (TCA cycle)
    EIM92_15565
   00620 Pyruvate metabolism
    EIM92_15565
Enzymes [BR:plen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EIM92_15565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn NQRA
Motif
Other DBs
NCBI-ProteinID: AZK47395
UniProt: A0A3Q8S5C6
LinkDB All DBs
Position
3451754..3453055
Genome map
AA seq 433 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKVGDKVTDDDIIMEVQNDKAVVEVPCPVNGTVQEV
FGTDGAVFRVGQVVAVIDAEGDIPEQEAAPEEQSAQEADAAQGGADTKDSPATENPAASQ
GSAAPAAPNREVLATPSVRKFAREKGVDLSQVQGSGKAGKITREDVEAFLSGGGAPASAQ
ETAKAEDTAPAAAASAVSVSAEEERVPFKGIRKAISNAMVKSAYTAPHVTIMDEVDVTEL
VAFRTRMKPIAEKKGTKVTYLPFIVKALVAAARQFPALNASIDEENNEIVYKKHYDIGIA
TDTDNGLIVPVIKDADRKSIWMIADAIRDLATRGREGKLAANEMRGSTISITNIGSAGGM
FFTPIINYPEVAILGTGRISEKPVVKNGEVVVAPVMALSLSFDHRLIDGATAQYFMNYIK
ELLSNPELLVMEV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaatttgaatatcgattccctgagcttggtgagggactgcatgaaggcgaaatt
ataaaaatgcatatcaaagtcggcgataaagtaactgacgacgatattattatggaagta
caaaatgataaggcggtcgttgaagtgccttgtccagtaaatggtacggtacaagaggta
ttcggtacggacggcgctgtgttccgcgtagggcaagtcgtagcggttattgacgctgaa
ggcgatattccagagcaggaagctgcgccggaagagcaaagtgcacaagaagctgatgct
gcgcaaggtggggccgacacgaaggactctccggctaccgagaatccagctgcaagccag
ggcagcgctgcaccagcggcacctaatcgcgaagtattggctaccccaagtgttcgcaag
tttgctcgcgagaagggtgtagaccttagccaagtgcaaggctccggcaaggcaggtaaa
attacccgcgaggatgtagaggcattcctgagcggtggcggagcaccagcatctgctcaa
gagaccgcgaaagctgaggatacagcacctgcagcagcagcttcggcagtcagcgtaagt
gcagaagaagaacgcgtgccgttcaaaggtattcgtaaggcgatctctaatgcaatggtt
aaatctgcctatacggcacctcacgttacgattatggatgaagttgacgtgactgagctt
gtggcgttccgtacgcgcatgaagccaattgcagagaagaaaggtacgaaagtgacttat
cttccattcatcgttaaagcgctcgttgcagctgctcgtcagttccctgcacttaacgct
tcgatcgacgaagagaacaatgagattgtatacaagaagcattatgatatcggtatcgca
accgatacggacaacggcttgattgtaccggttattaaggatgctgatcgtaagagcatt
tggatgattgcagacgcgattcgcgatttggctactcgcggccgtgaaggcaaattggct
gccaacgaaatgagaggcagtacgatctctattacaaacatcggctctgccggcggtatg
ttcttcactcctatcattaattacccagaggtagccatcctgggaactggtcggattagc
gagaagccggttgtgaagaacggtgaggtcgttgtagctccggttatggctctgtccctc
agctttgaccatcgtctgatcgatggggcaactgctcagtatttcatgaactatatcaaa
gagctgctctccaaccctgagctgctcgtaatggaggtataa

DBGET integrated database retrieval system