KEGG   Pleomorphomonas sp. SM30: OHA_1_00020
Entry
OHA_1_00020       CDS       T05766                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00471  D-Glutamine and D-glutamate metabolism
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    OHA_1_00020 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00020 (murI)
Enzymes [BR:pleo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     OHA_1_00020 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Racemase
   OHA_1_00020 (murI)
SSDB
Motif
Pfam: Asp_Glu_race
Other DBs
NCBI-ProteinID: BBE70458
LinkDB
Position
1:22525..23334
AA seq 269 aa
MRVLVFDSGVGGLSVAREIAAALPGACLHYLADTAVFPYGALEPDVLVARVVDLIGGAVA
TSAPAAVVIACNTASTLVLGPLRARFPMPIVGTVPAVKPAAETSRSRMVSVLATPGTVKR
DYTRDLIATHGGDCRFTLVGSARLAELVEDVHGSRSVPDEAFAAEIAPCFVEADGRRTDT
VVLACTHYPLVLDRLRRLAPWPVTWIDPAPAIARRTAVVTAEAAQGWAAGDSTGPNRFFA
TGRLPETAFLARFGFPAAESFAAAATVPA
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcgcgtcctggtgttcgacagcggcgtcggcggcctgtccgtcgcgcgcgagatcgcc
gccgcgctgcccggggcctgcctgcattatctcgccgacaccgcggtgttcccctacggc
gcgctcgagcccgacgtgctggtggcgcgcgtcgtggatctgatcggcggcgcggtcgcg
acctcggcaccggcggcggtggtgatcgcctgcaacaccgcctcgacgctggtgctgggt
ccgctcagggcccgcttccccatgccgatcgtcggcaccgtgccggcggtcaagccggcg
gccgagaccagccggagccggatggtctcggtgctggcgacgccgggcacggtgaagcgc
gactacacccgcgacctgatcgccacccacggcggcgactgccgcttcacgctggtcggc
tcggcgcgcctcgccgagttggtcgaggacgtccacggcagccggagcgtgccggacgag
gcgttcgcggccgagatcgcgccctgtttcgtcgaggcggacggccggcgcaccgacacg
gtggtgctggcctgcacccattatccgctggtgcttgaccggttgcggcggctggcgccc
tggccggtgacctggatcgacccggcgccggcgatcgcacgacgcacggcggtcgtgacc
gccgaggccgcgcagggctgggccgcaggcgattcgaccggtccgaaccgcttcttcgcc
accggccggctgccggagacggccttcctcgcccgcttcggcttcccggccgcggagagc
ttcgccgcggcggcgaccgtgccggcctga

DBGET integrated database retrieval system