KEGG   Pleomorphomonas sp. SM30: OHA_1_00124
Entry
OHA_1_00124       CDS       T05766                                 

Gene name
uppS
Definition
(GenBank) ditrans,polycis-undecaprenyl-diphosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo00900  Terpenoid backbone biosynthesis
pleo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_00124 (uppS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OHA_1_00124 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pleo01006]
    OHA_1_00124 (uppS)
Enzymes [BR:pleo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     OHA_1_00124 (uppS)
Prenyltransferases [BR:pleo01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   OHA_1_00124 (uppS)
SSDB
Motif
Pfam: Prenyltransf HTH_DeoR
Other DBs
NCBI-ProteinID: BBE70560
LinkDB
Position
1:129038..129799
AA seq 253 aa
MTTGMDAVRQSFGRPDGFPRHVAIIMDGNGRWARARGLPRVEGHRRGLQTLREIVRHAGD
VGLECLTLYSFSSENWSRPAEEVRELMGLLKIFIRRDLAELDRAGVRVRVVGERAGLAAD
IAGLLDEAETTTAANTGLTLVVAFNYGARNEIARAVRALARDVAAGRLAPEAIDEAAIGR
RLDTADMPDPDLIIRTSGEQRLSNFLLWQAAYSEFLFVPTYWPDFSAAEFDRAIDEYLGR
ERRFGGLKAGVGV
NT seq 762 nt   +upstreamnt  +downstreamnt
atgacgacggggatggacgctgtgcggcagagtttcgggcgcccggacggcttcccgcgt
cacgtggccatcatcatggacggcaacgggcggtgggcgcgcgcgcgcggcctgccgcgg
gtggaggggcaccgccgcggcctgcagacgctgcgcgagatcgtccgccacgccggcgac
gtcggcctcgagtgcctgacgctctactccttctcgtcggagaactggagccggcccgcg
gaagaggtccgcgagctgatggggctcctcaagatcttcatccgccgcgacctcgccgaa
ctcgaccgcgccggcgtccgtgtccgcgtcgtcggcgagcgcgcaggtttggccgccgac
atcgccggcctgctcgacgaggccgagaccaccaccgccgccaacaccggcctgacgctg
gtggtcgccttcaactacggtgcccgcaacgagatcgcccgcgcggtccgggccctggcg
cgcgacgtcgccgccggccggctcgcgcccgaggcgatcgacgaggccgcgatcggccgg
cggctcgacaccgccgacatgccggaccccgacctgatcatccgcaccagcggtgaacag
cggctctccaatttcctgctctggcaggcggcctactccgagttcctgttcgtgccgacc
tactggccggacttctccgccgccgaattcgaccgcgccatcgacgagtatctcggccgc
gagcgccggttcggcggcctcaaggcgggggtcggcgtctga

DBGET integrated database retrieval system