KEGG   Pleomorphomonas sp. SM30: OHA_1_00477Help
Entry
OHA_1_00477       CDS       T05766                                 

Gene name
argE_1
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00220  Arginine biosynthesis
pleo01100  Metabolic pathways
pleo01110  Biosynthesis of secondary metabolites
pleo01130  Biosynthesis of antibiotics
pleo01210  2-Oxocarboxylic acid metabolism
pleo01230  Biosynthesis of amino acids
Module
pleo_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    OHA_1_00477 (argE_1)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     OHA_1_00477 (argE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer LytR_C
Motif
Other DBs
NCBI-ProteinID: BBE70909
UniProt: A0A2Z6HXS9
LinkDB All DBs
Position
1:complement(501983..503200)
Genome map
AA seq 405 aa AA seqDB search
MTAGSLPGAGSPSGAAPDLGAALGLLDRLVAFPTVSRDGNLDLIRWVADRLAEAGIAARL
YPAPSGDRASLFATIGPPGAGGVVLSGHTDVVPVTGQAWTSDPFRLRADGGRLHGRGTAD
MKGFVACAIEAATAAAGRRLARPLHLALSYDEEIGCVGVRPMLADLAAAGLSPGLVLVGE
PTSMTVATGHKGKLAARALCRGHAAHSALAPTGLNAIHLAADFVAALRAEQAALEAEGAR
DPGYDVPYTTVHAGLIAGGTALNIVPDAAGVDFEIRDVAAAESRAVLDRLFAAAERISAP
GRTRFPETGIALTVENAYPGLDTDRAGTAARTAAALAGTGFSKVAFGTEGGLFVEALGAP
VVVCGPGSMDQGHKPDEFVTAADLSACRAMLARLVDRLGDGAASE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgggtcgctacccggcgccgggtcaccatccggcgcggcgcccgacctcggc
gcggcgctcggcctgctcgaccgtctcgtcgctttcccgaccgtcagccgcgacggcaac
ctcgacctgatccgctgggtcgcggaccggctcgccgaggccgggatcgcggcacggctc
tacccggccccctccggcgaccgcgcgagccttttcgccaccatcggcccgcccggcgcc
ggcggcgtcgtgctctccggccacaccgacgtggtgccggtgaccggacaggcgtggacg
tccgacccgttccgcctccgggccgacggcggccggctgcacggccgcggcaccgccgac
atgaagggattcgtcgcatgcgcgatcgaagcggcgacggccgccgcgggaaggcggctc
gcccggccgctccatctggcgctctcctacgacgaggagatcggctgcgtcggcgtccgg
ccgatgctggccgacctcgccgcggccgggctgtcgccggggctggtgctggtcggcgag
cctacgtcgatgacggtcgcgaccggccacaagggcaagctcgccgcccgcgcgctctgt
cgcggccacgccgcccactccgccctcgctccgaccggcctcaacgccatccatctcgcc
gccgacttcgtggcggcgctgcgcgccgagcaggccgccttggaggccgagggcgcgcgc
gatcccggctacgacgtgccctacaccaccgtccacgccgggctgatcgccggcggcacg
gcgctcaacatcgtgccggacgccgccggcgtcgacttcgagatccgcgacgtcgcggcc
gcggagtcccgcgccgttctggaccgtctgttcgcggcggccgagcgcatctcggcgccg
ggccggacgcgttttccggagacggggatcgccctcaccgtcgagaacgcctatcccggg
ctcgacaccgaccgcgccggcaccgccgcccgcaccgcggccgccctcgccggcaccggc
ttctccaaggtcgccttcggcaccgagggcgggctgttcgtcgaggcgctcggggcgccg
gtggtggtgtgcgggccgggctcgatggaccagggccacaagcccgacgagttcgtgacc
gccgccgacctttccgcctgccgggcgatgctcgcccgtctggtcgaccggctcggcgac
ggcgcggcttcggaatag

DBGET integrated database retrieval system