KEGG   Pleomorphomonas sp. SM30: OHA_1_00519
Entry
OHA_1_00519       CDS       T05766                                 

Definition
(GenBank) murein L,D-transpeptidase
  KO
K21470  L,D-transpeptidase YcbB
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pleo01002]
    OHA_1_00519
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00519
Peptidases and inhibitors [BR:pleo01002]
 Cysteine peptidases
  Family C82
   OHA_1_00519
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Transpeptidase
   OHA_1_00519
SSDB
Motif
Pfam: YkuD PG_binding_1
Other DBs
NCBI-ProteinID: BBE70950
LinkDB
Position
1:548522..549781
AA seq 419 aa
MTLRQTIASTTHRAAPSRRAVLKAGLAAGFSAAAFSAEAQTLMAQTEWFENFDTSGPQQA
PIRSARPTLSSATAGYTEQAIATYSDIAARGGWNTVPGEQTLKIGVRSGNVVALRQRLAV
TGDISASGGNADSFDTFVDDAVRRFQLRHGLNADGVVAGDTLRQLNVPVDVRLRQLEVNL
VRARTFAGDLGGRYVMVNIPGAEIETVDADLVHSRHQAVVGKIDRQTPLLVSKINLIKFN
PFWTVPKSIIIKDLIPKMQQDSGYLDRQKIHIYDQRGTELDWRNINWNSDEAVNYMFRQD
PGDLNSMGSVKIEFPSPEGVYMHDTPSKGLFGENARFHSSGCVRVQNVREYVFWILKNTT
DWPQERIIQAMTSGERIDAPVADPVPLYFQYVTAWATPDGIVQFRDDIYQRDGLEVAAQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
gtgacccttcggcagacgatcgcctcgacgacccatcgcgccgcgccgagccgccgcgcc
gtgctgaaggccggcctcgccgccgggttctccgccgcggccttctcggccgaggcgcag
acgctgatggcgcagaccgagtggttcgagaatttcgacacctccggtccgcagcaggcg
ccgatccgctcggcgcgtccgacgctgtcgtcggcgaccgccggctacaccgagcaggcg
atcgccacctattccgacatcgccgcccgcggcggctggaacaccgtgcccggcgagcag
acgctgaagatcggcgtgcgcagcggcaacgtggtcgccctgcgccaacgcctcgccgtc
accggcgacatctcggccagcggcggcaacgccgacagcttcgacaccttcgtcgacgac
gcggtccgccgtttccagctccgccacggcctcaacgccgacggcgtcgtcgccggtgac
acgctgcgccaactcaacgtgccggtcgacgtccggctgcgccagctcgaggtcaaccta
gtgcgtgcgcgcaccttcgccggcgacctcggcggccgctacgtgatggtcaacatcccc
ggcgccgagatcgagaccgtcgacgcggacctcgtccattcccgccatcaggcggtggtc
ggcaagatcgaccgccagacgccgcttctggtgtcgaagatcaacctgatcaagttcaat
ccgttctggacggtcccgaagtccatcatcatcaaggacctgatcccgaagatgcagcag
gactcgggatacctggaccggcagaagatccacatctacgaccagcgcggcaccgagctc
gactggcgcaacatcaactggaactcggacgaagcggtcaactacatgttccgccaggat
ccgggcgacctcaattcgatgggctcggtcaagatcgagttcccctcgccggaaggcgtc
tacatgcacgacacgccctcgaagggcctgttcggcgagaacgcgcgcttccactcctcg
ggctgcgtgcgcgtgcagaacgtgcgcgagtacgtgttctggatcctgaagaacaccacc
gactggccgcaggagcgcatcatccaggcgatgacctcgggcgagcgcatcgacgcgccg
gtggccgatccggtgccgctctacttccagtacgtcaccgcctgggcgacgccggacggc
atcgtccagttccgcgacgacatctaccagcgcgacggcctcgaggtcgccgcgcagtga

DBGET integrated database retrieval system