KEGG   Pleomorphomonas sp. SM30: OHA_1_00544
Entry
OHA_1_00544       CDS       T05766                                 

Gene name
amiC_1
Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase AmiC precursor
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    OHA_1_00544 (amiC_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00544 (amiC_1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pleo03036]
    OHA_1_00544 (amiC_1)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     OHA_1_00544 (amiC_1)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   OHA_1_00544 (amiC_1)
Chromosome and associated proteins [BR:pleo03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    OHA_1_00544 (amiC_1)
SSDB
Motif
Pfam: Amidase_3 AMIN DUF440
Other DBs
NCBI-ProteinID: BBE70975
LinkDB
Position
1:575981..577258
AA seq 425 aa
MSRRLALAALPVLAALATTPLPARAETVPATAAAPDKAAAAYPVASDGRVVGDAARTRFV
LDLDRAVDVAAFTLGDPYRVVIDLPQVRFSLPAGSGAEGRGLVSGWRYGLLAIGRSRIVI
DATGPVKIDKSFVLPSVDGQPARLVVDLVGTTPEAFRDDLQRTAVEREVANDVPVAKGDR
LPGPRPTGHDRPLVMLDPGHGGVDSGTISPSGALEKDVVLAFAFELEKKLEASGKVDVAM
TRRDDTFVPLGDRVRIARDQAADLFVSIHADSVRQNDVRGATIYTLSDRASDREAAALAD
KENASDAVAGLDLDRQTDEVSDILIDLTRRETRNFSVSFANNLVSELSSTTRMIRNPHRF
AGFRVLKAPDVPSVLVEIGYLSNEQDEKLLTSEEWRGRVTDAIGAAVTRFFGRKLAGVET
TGSTN
NT seq 1278 nt   +upstreamnt  +downstreamnt
ttgtcgcgccgtctcgcccttgccgccctcccggtcctcgccgccttggcgacgacaccg
ttgcccgcgcgcgccgagacggtgcccgcgacggccgccgcgccggacaaggccgcggcc
gcctatcccgtggccagcgacggccgcgtcgtcggcgacgccgcccgcacccgcttcgtg
ctcgacctcgaccgcgcggtcgacgtagcggccttcaccctcggcgatccctaccgcgtc
gtgatcgacctgccgcaggtgcgcttctccctgccggccggttcgggcgccgagggcagg
ggcctcgtctcggggtggcgctacggcctgctcgcgatcgggcgctcgcgcatcgtgatc
gacgccaccggtccggtgaaaatcgacaagtccttcgtgctgccctcggtcgacggtcag
ccggcgcgcctcgtcgtcgacctcgtcggcaccacgcccgaagccttccgcgacgacctg
cagcgcaccgccgtcgagcgcgaggtcgccaacgacgtgcccgtcgccaagggcgaccgt
ctgcccggcccgcgcccgaccggtcacgaccggccgctggtgatgctcgacccgggccac
ggcggcgtcgattccggcacgatctcgccgtcgggtgcgctcgagaaggacgtggtgctc
gccttcgcgttcgagctcgagaagaagctcgaggcctccggcaaggtcgacgtcgcgatg
acgcggcgcgacgacaccttcgtgccgctcggcgaccgcgtgcggatcgcgcgcgatcag
gcggcggacctgttcgtctcgatccacgccgattcggtgcgccagaacgacgtgcgcggc
gccacgatctacaccctgtccgaccgggcctccgaccgcgaagcggccgcgctcgcggac
aaggagaacgcctccgacgccgtcgccggtctcgacctcgatcgccagaccgacgaagtc
tccgacatcctgatcgacctgactcggcgcgagacccggaatttctcggtctccttcgcc
aacaacctcgtctccgagctgtcgtcgaccacgcggatgatccgcaatccccaccgcttc
gccggcttccgggtgctcaaggcgccggacgtgccgtcggtgctggtcgagatcggctat
ctctccaacgagcaggacgagaagctcctgacctcggaggagtggcgcggccgcgtgacc
gacgcgatcggcgcggcggtgacgcgcttcttcggccgcaagctcgccggcgtcgagacc
accggttcgaccaactga

DBGET integrated database retrieval system