KEGG   Pleomorphomonas sp. SM30: OHA_1_00758Help
Entry
OHA_1_00758       CDS       T05766                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00010  Glycolysis / Gluconeogenesis
pleo00020  Citrate cycle (TCA cycle)
pleo00620  Pyruvate metabolism
pleo01100  Metabolic pathways
pleo01110  Biosynthesis of secondary metabolites
pleo01120  Microbial metabolism in diverse environments
pleo01130  Biosynthesis of antibiotics
pleo01200  Carbon metabolism
Module
pleo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OHA_1_00758 (aceF)
   00020 Citrate cycle (TCA cycle)
    OHA_1_00758 (aceF)
   00620 Pyruvate metabolism
    OHA_1_00758 (aceF)
Enzymes [BR:pleo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OHA_1_00758 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: BBE71188
UniProt: A0A2Z6HY09
LinkDB All DBs
Position
1:815670..817013
Genome map
AA seq 447 aa AA seqDB search
MPIEILMPALSPTMEKGNLAKWTVKEGDTVKSGDVIAEIETDKATMEVEAVDEGVVAKIV
VPAGTQDVAVNAVIALLAAEGEDVAAAGAGKAPAKAEAAPATAPASAPAPAPAAPAASAP
AAASAPAKAEGGRIFASPLARRVAKDKGVDLAAVKGSGPHGRIVLRDVEKAEPGAKPAAA
APAPAPAAAAPAPAPKPALATGPSDEMTLKLFEPGSYEVIPHDGMRKTIARRLTESKQTV
PHFYLTVDIELDALLALRTQLNDAAPTVDGKPTYKLSVNDLVVKAYALALRSVPDANVSW
TDGGMLRHKVVDVGVAVSIPGGLITPIIRGADKKPVSQISNEIKDLAKRAKDRKLKPEEY
QGGTTSVSNLGMFGVKDFAAVINPPHATILAVGAGDQRAVVKGGQLAVATVMSVTLSTDH
RAVDGALGAQLVQAFKGYVEKPFSMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgagatcctgatgccggcgctctctcccacgatggagaagggcaatctggcc
aagtggaccgtcaaggagggcgacacggtcaagtccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaggtcgaggccgtcgacgagggcgtcgtcgccaagatagtg
gtgcccgcgggcacccaggacgtggcggtcaacgcggtgatcgcgctgctcgccgccgag
ggcgaggacgtcgcggccgccggcgccggcaaggcgccggccaaggccgaggcggcgccc
gccacggcccccgcgtcggctcccgctccggcgcccgcggcgccggccgcgtcggctccc
gccgcggcgtctgcgccggccaaggccgagggcggccgcatcttcgcctcgccgctcgcc
cgccgggtggcgaaggacaagggcgtcgacctcgccgcggtcaagggctccggcccgcac
ggccgcatcgtgctgcgcgacgtcgagaaggccgagccgggtgccaagcccgccgcggcc
gccccggcgccggccccggccgccgccgctccggcccccgcgccgaagccggcgctcgcg
accggcccgtcggacgagatgacgctgaagctgttcgagccgggcagctacgaggtgatc
ccgcacgacggtatgcgcaagacgatcgcgcggcggctcaccgagtcgaagcagaccgtc
ccgcacttctacctgacggtcgacatcgagctcgacgcgctgctggcgctgcgcacccag
ctcaacgacgccgcgccgacggtcgacggcaagccgacctacaagctctcggtcaacgac
ctcgtcgtgaaggcctacgccctcgcgctgcggtcggtgccggacgccaacgtgtcgtgg
accgacggcggcatgctccgccacaaggtcgtggacgtcggcgtcgccgtgtcgatcccg
ggcggcctgatcacaccgatcatccgcggcgccgacaagaagccggtgtcgcagatctcg
aacgagatcaaggacctcgccaagcgcgccaaggaccgcaagctgaagccggaagaatac
cagggcggcaccacctcggtgtccaacctcggcatgttcggggtgaaggactttgccgcc
gtcatcaatccgccgcacgccaccatcctggcggtcggcgccggcgaccagcgcgcggtg
gtcaagggcggccagctcgcggtggccacagtgatgagcgtcacgctctccaccgaccac
cgcgcggtcgacggcgcgctcggcgcgcagctggtccaagccttcaagggctacgtcgag
aagccgttctcgatgctggtctga

DBGET integrated database retrieval system