KEGG   Pleomorphomonas sp. SM30: OHA_1_00829
Entry
OHA_1_00829       CDS       T05766                                 

Gene name
dacD
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacD precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_00829 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pleo01002]
    OHA_1_00829 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00829 (dacD)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OHA_1_00829 (dacD)
Peptidases and inhibitors [BR:pleo01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   OHA_1_00829 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   OHA_1_00829 (dacD)
SSDB
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Other DBs
NCBI-ProteinID: BBE71258
LinkDB
Position
1:897133..898302
AA seq 389 aa
MVLGPRHARCSGRIAAALLLSLALSPAPASALDTPAPRALVVESDTGSVLYAKADDDRFA
PANFAKLMTAAVVFDALAAGEIREDDVYTVSEAAWRAGGAPARVTTMFAAPRSTVTVGDL
LRGLVVHYANDAALVLAAGFPGGETAFVRRMNETAARLGMTDSRFVNPTGFAAPGATTSV
RDLRRLIDYIRTTHPDRYALYALPEFTWNKIRQTNKTGFLRDTAGVEGLVLAYDADALFG
AAVSAVRGGRRMLVLASGFRSSAERDKQVKALLDAAYADFSTVQLFPAGATVGSVRVFGG
AAGRVDVTGAGPVAVTLPTRDRDGFRAAIAYEGPIPAPVRAGATVARIEITIDGRLYQTI
PLVAARDVPVGGLSDRARDGLSELLFGWW
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggtcctcggcccaagacacgcccgttgttcgggtcggatcgccgccgcgctgctgctt
tcgctcgcactgtcacccgctccggcgtcggctttggacacgccggcgccgcgcgccctc
gtcgtcgagagcgacaccggttcggtgctctacgccaaggccgacgacgaccgcttcgcg
cccgccaatttcgccaagctgatgaccgccgccgtggtgttcgacgcgcttgccgccggc
gagatccgcgaggacgacgtctacacggtgagcgaggcggcctggcgcgccggcggcgca
cccgcccgcgtcaccaccatgttcgccgcgccacgctcgaccgtcacggtcggcgacctc
ctgcgcggcctcgtcgtccactacgccaacgacgccgcgctggtgctggcggccggcttc
cccggcggcgaaaccgccttcgtgcgccggatgaacgagacggcggcgcgcctcggcatg
accgacagccgcttcgtcaatccgaccggcttcgccgcgcccggcgcgaccacgtcggtc
cgcgatctccgccgcctgatcgactacatccgaaccacccacccggaccgctacgcgctc
tacgcgctgcccgagttcacctggaacaagatccgccagaccaacaagaccggcttcctg
cgcgacaccgcgggggtcgagggcctcgtgctcgcctacgacgccgacgccctgttcggc
gccgccgtctcggcggtgcgcggcggccggcggatgctggtgctggcgagcggcttccgc
tcgagcgccgagcgcgacaagcaggtcaaggcgctgctcgacgccgcctacgccgacttc
tcgaccgtgcaactgttccccgccggcgcgacggtcggctcggtgcgggtgttcggcggc
gcggcggggcgggtcgacgtcaccggcgccggcccggtcgcggtgacgctgccgacccgc
gaccgcgacggcttccgcgccgccatcgcctacgagggaccgatcccggcgccggtgcgg
gccggcgccaccgtggcccggatcgagatcaccatcgacggccggctctatcagacgatc
ccgttggtcgccgcccgcgacgtgccggtcggcgggctctcggaccgggcccgcgacggc
ctttccgaactgctgttcggctggtggtga

DBGET integrated database retrieval system