KEGG   Pleomorphomonas sp. SM30: OHA_1_00882
Entry
OHA_1_00882       CDS       T05766                                 

Gene name
slt_2
Definition
(GenBank) soluble lytic murein transglycosylase precursor
  KO
K08309  soluble lytic murein transglycosylase [EC:4.2.2.-]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_00882 (slt_2)
Enzymes [BR:pleo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     OHA_1_00882 (slt_2)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   OHA_1_00882 (slt_2)
SSDB
Motif
Pfam: SLT TPR_16 TPR_19 TPR_4
Other DBs
NCBI-ProteinID: BBE71309
LinkDB
Position
1:complement(967849..970002)
AA seq 717 aa
MPWAHRLAAATSLVFAGALVGAVIAVPNPFARPGGPTLGVPSPDGPATTGSTRVAAVPAA
PVRTTTAVDVAALSAGDLTGALPHAALDVSDGLRAALDALDGKDYAAAMQVASSLPDLER
DIVTWVAIRRGLDGPSPRAITEFARAHPHWPSATLMRSRAEQALARSADLAPADLAAAYD
AAPPVSDTGMFSLVRAYRALGRTEDARVLLAKWWASESLSPQEDAAILKSYGDLLTPADH
KTRFEMLMARDRVTQAGALAKFVGPDAQTLVAARAAVVRGARDAAAKLAAVPAALQKEPI
HLFSVAEWNRRQNRPRDAAAALLAVDPAATLAEADEWWVERRIVSRDLIERGEAKLAYQV
VAAHSGGSSETLQEAHFHAGWYALRFLNDPARAIPHFEALQNVSSKPISRARAAYWLGRA
EEAAGRMEDARQHYTVAAADEIAFYGQLARVKLGRDALELPPLPEPTEADRKAFAENDLC
RALAILIAAGRERDAAVIYPELARRLPSGGQVRLLADFVQRRGDHRLALQIGKIAADRGL
GVERLAFPVDSIPEPARKGTAVETAMVYAIARQESAFDPRAVSHAGARGLLQLMPATAAA
TARKIGVAFSADKLTDDPGLNAKLGAAHLKDLVDTFDGSYILTFAAYNAGPGKAREWIQR
FGDPRNPKVDPIDWIELIPYGETRNYVQRVTENLQVYRERLAAGTLGIAADLRRGSS
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgccgtgggcgcaccggctcgccgctgcgacgagcctcgttttcgccggagccctggtc
ggagccgtgatcgcggttccgaacccgttcgcgcgccccggcggcccgaccctcggcgtc
ccgtcgcccgacggacccgccacaaccggatcgacccgggtcgcggccgtgcccgcggcg
cccgtccgcaccaccaccgcggtcgacgtcgccgcgctgtcggccggcgacctcaccggc
gccctgccccacgccgcgctcgacgtctccgacggcctgcgcgccgccctcgacgcgctc
gacggcaaggactacgcggcggcgatgcaggtggcgtcgagcctgccggacctcgagcgc
gacatcgtcacctgggtcgcgatccgccgcggcctcgacggcccgagcccgcgcgccatc
accgaattcgcccgtgcccatccgcactggccgagcgcgacgttgatgcgctcgcgcgcc
gaacaggcgctcgcccgctccgccgacctcgcccccgccgacctcgcggccgcctacgac
gccgcgccgccggtgagcgacacgggcatgttctcgctggtgcgcgcctaccgggccctc
ggccggaccgaggacgcccgtgtcctgctcgccaagtggtgggcgagcgagagcctgtcg
ccgcaggaggacgcggcgatcctgaagagctacggcgacctcctgacgccggccgaccac
aagacccgcttcgagatgctgatggcgcgcgaccgcgtcactcaagccggggcgctcgcc
aagttcgtcggcccggacgcccagaccctggtcgcggcccgcgccgccgtggtgcgcggc
gccagggacgccgccgccaagctggcggccgtgccggcggcgctgcagaaggagccgatc
cacctgttctcggtcgccgagtggaaccgccgccagaaccgcccgcgcgacgcggcggcg
gccctgctcgccgtcgaccccgccgccaccctcgccgaggccgacgagtggtgggtggag
cgccgcatcgtctcgcgcgacctgatcgagcgcggcgaggccaagctcgcctaccaggtg
gtcgccgcccacagcggcggctcgtcggagacgctccaagaggcccatttccacgccggc
tggtacgccctgcgcttcctgaacgacccggcgcgggcgatcccgcatttcgaggcgttg
cagaacgtctcctcgaagccgatcagccgcgcccgcgccgcctattggctcggccgcgcc
gaggaggccgccggccggatggaggacgcccgccagcactatacggtcgccgccgccgac
gagatcgccttctacggccagctcgcccgggtcaagctcggccgcgacgccctcgagctg
ccgccgctgccggagccgaccgaggccgaccgcaaggccttcgccgagaacgacctctgc
cgcgccctcgccatcctgatcgccgccggccgcgagcgcgacgccgcggtgatctacccc
gaactcgcccgccggctgccctcgggcggacaggtgcggctgctcgccgacttcgtgcag
cgccgcggcgaccaccgcctcgccctccagatcggcaagatcgccgccgaccgcggcctc
ggcgtcgagcgcctcgccttcccggtggattcgatccccgagccggcgcgcaaggggacg
gcggtcgagaccgccatggtgtacgccatcgcccgccaggagagcgctttcgacccgcgc
gccgtcagccatgccggtgcccgcggcctgttgcagctgatgccggcgaccgccgccgcg
acggcgcgcaagatcggcgtcgccttctcggccgacaagctgacggacgatcccggcctc
aatgccaagctcggcgccgcccatctcaaggacctcgtcgacaccttcgacggctcctac
atcctcaccttcgccgcctacaacgcaggccccggcaaggcgcgcgagtggatccagcgc
ttcggcgatccgcgcaatccaaaggtcgacccgatcgactggatcgagctgatcccatac
ggcgagacccgcaactacgtgcagcgcgtcactgagaatttgcaagtctaccgcgagcgg
ctcgcggcgggtacgctggggatcgcggcggaccttcgccgtgggagcagttga

DBGET integrated database retrieval system