KEGG   Pleomorphomonas sp. SM30: OHA_1_00891
Entry
OHA_1_00891       CDS       T05766                                 

Gene name
dat_1
Definition
(GenBank) D-alanine aminotransferase
  KO
K00824  D-alanine transaminase [EC:2.6.1.21]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00310  Lysine degradation
pleo00330  Arginine and proline metabolism
pleo00360  Phenylalanine metabolism
pleo00472  D-Arginine and D-ornithine metabolism
pleo00473  D-Alanine metabolism
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    OHA_1_00891 (dat_1)
   00330 Arginine and proline metabolism
    OHA_1_00891 (dat_1)
   00360 Phenylalanine metabolism
    OHA_1_00891 (dat_1)
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    OHA_1_00891 (dat_1)
   00473 D-Alanine metabolism
    OHA_1_00891 (dat_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pleo01007]
    OHA_1_00891 (dat_1)
Enzymes [BR:pleo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     OHA_1_00891 (dat_1)
Amino acid related enzymes [BR:pleo01007]
 Aminotransferase (transaminase)
  Class IV
   OHA_1_00891 (dat_1)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: BBE71318
LinkDB
Position
1:978960..979823
AA seq 287 aa
MSRIAYVNGRYVPHRDAAVHVEDRGYQFADGVYEACEIRAGAIVDLRRHLDRLDRSLAEL
RIAAPMGRGALVTVIRETARRNRVRDGIVYLQVTRGVAPRDHAFPPASVRPALVVTCKPM
DRAAAERRAETGVAVVTVLDNRWDRVDIKTVGLLPNALAKQAAREAGAYEALFVDADGNV
TEGASTNAWIVDRDGRLVTRPADHGILRGITRTVVIETARAAGVEVVERKFTVAEAKAAR
EVFVTAASTIVMPVVRIDGAAVANGAPGSVATLLRARFHEFAERTPI
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtcccgcattgcctatgtcaacggtcgctacgtgccgcaccgcgacgccgcggtgcac
gtggaggaccgcggctaccagttcgccgacggcgtctacgaggcctgcgagatccgcgcc
ggcgccatcgtcgacctgcggcgccatctcgatcggctcgaccgctcgctcgccgaactg
cgcatcgccgcgccgatggggcgcggtgcgctcgtcacggtgatccgcgagaccgcgcgc
cgcaaccgcgtccgcgacggcatcgtctacctccaggtcacccgcggcgtcgccccgcgc
gaccacgcctttccgccggcgtcggtccggccggcgctggtcgtgacctgcaagccgatg
gaccgcgccgccgccgagcgccgcgccgagaccggcgtcgccgtcgtcaccgtgctggac
aaccgctgggaccgggtcgacatcaagaccgtcggcctcctgccgaacgcgctcgccaag
caggccgcccgcgaggccggcgcctacgaggcgctgttcgtcgacgccgacggcaacgtc
accgagggcgcctccaccaacgcctggatcgtcgaccgcgacggccgcctcgtcacccgc
ccggccgaccacggcatcctccgtggcatcacccgcaccgtggtgatcgagacggctcgc
gcggccggcgtcgaggtggtcgaacgcaagttcacggtggcggaggcgaaggccgcgcgc
gaggtcttcgtcaccgccgcctcgaccatcgtgatgccggtggtgcgcatcgacggcgcg
gccgtcgccaacggcgcgccgggctcggtcgcgacgctgctgcgcgcccgcttccatgaa
ttcgccgagcggaccccgatctga

DBGET integrated database retrieval system