KEGG   Pleomorphomonas sp. SM30: OHA_1_01161Help
Entry
OHA_1_01161       CDS       T05766                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacA precursor
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OHA_1_01161 (dacA)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OHA_1_01161 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 SPOR Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BBE71583
UniProt: A0A2Z6HWK6
LinkDB All DBs
Position
1:1253338..1254975
Genome map
AA seq 545 aa AA seqDB search
MQSWRARLGTAIKAAVAVVLAGGIAAGATGEARAAAPAGVYPDKYAAIVVDTATGKVLYE
ANADGRRYPASLTKMMTLYVLFEDLERGRFRLDSRLEVSRNASAQPPSKLGLRPGDTITV
EEAIKGLVTKSANDAAATIGENLAGSVPAFADRMTRTARALGMSNTRFRNANGLPDPGQY
TSARDMMKLGVALQVRFPTYYEFFKTRSFTFRGKVHGNHNRLLGAVDGVDGIKTGYINAS
GFNLVSSVKRDGRKIVAVVMGGRTARSRDAHMVRLIEAYLPLASRGRGYDDELVAAVRSA
PKVAASAPHPVPEALQAAAPEAVEHPQPSPRPVQVAADGMPEIVTASVVPTAVPESAPQP
VAAARQVRVEAIPVPVSEPVSLATAKLPSSAAEAFGDVAPLSSAERDALGSMIEQTIGEG
DAEPIEVASVDSDIAAPTPRRTATARSVAPPAPAAVREEARAAARGWMIQIGAVPSKAAA
ADLIRRAQAKGGKALAAADPVTETVSKGGQTLVRARFAGFESEKAASRACAALKRSDMNC
YSFRL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgcagagttggcgtgcgagactgggaaccgcgatcaaggccgccgtcgcggtcgtcctg
gccggtggcatcgccgccggcgcgaccggggaggcccgggcggccgcgcccgcgggcgtc
taccccgacaagtacgcggccatcgtggtcgacacggcgacgggcaaggtcctctacgag
gccaacgccgacgggcgccgctatccggcctctttgaccaagatgatgacgctctacgtc
ctgttcgaggacctcgagcgcggccgcttccgcctcgacagccggctcgaggtgtcgcgc
aacgcctcggcgcagccgccgtcgaagctcggcctccggcccggcgacaccatcacggtc
gaggaggcgatcaagggcctcgtcaccaagtcggccaacgacgctgccgcgaccatcggc
gagaacctcgccggttcggtgccggccttcgccgaccggatgacgcggaccgcccgcgcc
ctcggcatgagcaacacccgcttccgcaacgccaacggcctgcccgatcccggtcagtac
acctcggcgcgcgacatgatgaagctcggcgtcgctctccaggtgcgcttcccgacctat
tacgagttcttcaagacccgctccttcaccttccgcggcaaggtgcacggcaaccacaac
cgtctgctcggtgcggtcgacggcgtcgacggcatcaagaccggctacatcaacgcctcc
ggcttcaacctggtcagctcggtgaagcgcgacggccgcaagatcgtggcggtggtgatg
ggcggccgcaccgcccgctcgcgcgacgcccacatggtccggctgatcgaggcctatctg
ccgctcgcctcccgcggccgcggctacgacgacgagctcgtcgccgccgtccgctcggcg
cccaaggtggccgcgtcggcgccgcatccggtgcccgaggcgctccaggccgccgcgccg
gaggcggtcgagcatccgcagccctcgccgcgcccggtccaggtcgccgcggacggcatg
ccggagatcgtcaccgcgtcggtggtcccgaccgccgtgcccgagagcgcgccgcagccg
gtcgccgccgcccgtcaggtccgtgtcgaggcgatcccggtgccggtgtccgagccggtg
tcgctcgccaccgccaagctgccgtcctcggcggccgaggccttcggcgacgtcgccccg
ctgtcgtcggccgagcgcgacgccctcggcagcatgatcgagcagaccatcggcgaaggc
gacgccgagccgatcgaggtcgcctcggtcgacagcgacatcgccgccccgacgccgcgc
cgtaccgccaccgcccggtccgtggcgccgccggccccggccgcggtgcgcgaggaggcc
cgtgccgccgcccgcggctggatgatccagatcggcgccgtgccctccaaggccgccgcc
gccgacctgatccgccgcgcccaggccaagggcggcaaggcgctcgccgccgccgatccg
gtcaccgagaccgtgtcgaagggtggccagaccctggtgcgcgcccgcttcgcaggtttc
gagtccgagaaggccgcgtcccgcgcctgcgccgcgctgaagcgcagcgacatgaactgc
tacagcttccggctctga

DBGET integrated database retrieval system