KEGG   Pleomorphomonas sp. SM30: OHA_1_02494
Entry
OHA_1_02494       CDS       T05766                                 

Gene name
murJ
Definition
(GenBank) putative peptidoglycan biosynthesis protein MurJ
  KO
K03980  putative peptidoglycan lipid II flippase
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_02494 (murJ)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pleo02000]
    OHA_1_02494 (murJ)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Flippase
   OHA_1_02494 (murJ)
Transporters [BR:pleo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   OHA_1_02494 (murJ)
SSDB
Motif
Pfam: MurJ Polysacc_synt_C
Other DBs
NCBI-ProteinID: BBE72895
LinkDB
Position
1:complement(2702804..2704375)
AA seq 523 aa
MSLVKNFATVGMATLSSRVLGFVRDVFMANMLGSGPIADAFFVAFRLPNLFRRLFAEGAF
SAAFVPLFARALAEGGDAGARRLAEEILAVFLLTLTVVTVIAELAAPLLVVVLAPGFSDE
PEKFSAAEAMSRIMFPYLACMSLTAMAAGMLQSFGRFAVAAFAPSLLNVVLVAALGLIWW
SGWAGTPNAAYTLSWAVFVAGFAQLLAVAGTLWWIGFPVSLLRPRWTDNVRRLVQLGIPG
VISGGITQINVVVGTIIASLQAGAVSWLYYADRIYQLPLGVIGVAIGVVLLPDLTRRLRT
ETVESVHHTQNRALEFAMALTLPATVALVAIPFTIMRVLFERGAFTPADTLATGWAVAAF
SAGLPAFVAIKVFQPSYFAREDTRTPTVQGGISLAVNVGGSLALFPFLGHVGIAAATSLA
ATVNAVMLLVVLVRRGHFAADRLLVRRLTLLAIASLLMGAALVVGADFAEPWLRDRRELV
SGGALAALCAGGMVVYGLAAVATGAVDVRRYGRAILARKRRGA
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgagcctcgtcaagaatttcgcgaccgtcggcatggcgacgctgtcctcgcgcgtgctc
ggcttcgtgcgcgacgtgttcatggccaacatgctcggctccgggccgatcgcggacgcc
ttcttcgtcgccttccggctgccgaacctgttccgccgcctgttcgccgagggcgccttc
tcggccgccttcgtgccgctgttcgcccgcgccctcgccgaaggcggcgacgccggcgcg
cgccggctcgccgaggagatcctggcggtcttcctcctgacgctgaccgtggtcaccgtg
atcgccgaactcgccgcgccgctcctggtcgtcgtgctcgcgcccggcttctccgacgag
ccggagaagttttccgccgccgaggcgatgagccggatcatgttcccctatctcgcctgc
atgtcgctgacggcgatggcggcgggcatgctgcagtccttcggccgcttcgccgtcgcc
gccttcgcgccgtcgctgctcaacgtcgtgctggtcgcggcgctcgggctgatctggtgg
tcgggttgggccggcacgccgaacgcggcctacacgctgtcctgggcggtgttcgtcgcc
ggcttcgcccagctcctggcggtcgccggcacgctgtggtggatcggcttcccggtgtcg
ctgctgcggccgcgctggaccgacaacgtccggcgcctcgtgcaactcggcatccccggt
gtgatctccggcggcatcacccagatcaacgtggtggtcggcaccatcatcgcctcgctg
caggccggcgcggtgtcctggctctactacgccgaccgcatctaccagctgccgctcggt
gtcatcggcgtcgccatcggcgtcgtgctgctgccggacctcacccggcgcctgcgcacc
gagacggtcgagagcgtccaccatacccagaaccgcgccctcgagttcgccatggccctg
acgctgccggcgacggtggcgctggtggcgatccccttcacgatcatgcgcgtgctgttc
gagcgcggcgccttcacgcccgcggacacgctcgccaccggctgggcggtggccgccttc
tcggccggcctgccggccttcgtggcgatcaaggtgttccagccgagctacttcgcccgc
gaggacacccgcacgccgacggtgcagggcggcatttcgctggcggtcaacgtcggcggc
tcgctggcgctgttccccttcctcggccacgtcggcatcgccgccgcgacctcgctcgcc
gccaccgtcaacgcggtgatgctgctggtggtgctggtgcgccgcggccacttcgccgcc
gaccggctgctggtgcgccgcctgacgctgctggcgatcgccagcctcctgatgggcgcc
gccctcgtcgtcggcgccgatttcgccgaaccctggctgcgcgaccggcgcgaactggtc
tccggcggcgcgctcgccgcgctctgcgccggcggcatggtggtctacggcctcgcggcg
gtcgccaccggagcggtggacgtccgccgctacggccgcgccatcctggcgcggaaacgc
cgcggcgcttga

DBGET integrated database retrieval system