KEGG   Pleomorphomonas sp. SM30: OHA_1_02927
Entry
OHA_1_02927       CDS       T05766                                 

Gene name
mltA
Definition
(GenBank) membrane-bound lytic murein transglycosylase A precursor
  KO
K08304  membrane-bound lytic murein transglycosylase A [EC:4.2.2.-]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_02927 (mltA)
Enzymes [BR:pleo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     OHA_1_02927 (mltA)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   OHA_1_02927 (mltA)
SSDB
Motif
Pfam: MltA 3D
Other DBs
NCBI-ProteinID: BBE73317
LinkDB
Position
1:complement(3208759..3209883)
AA seq 374 aa
MAAPARPARLRAVGFARLPGWAADDHAAAFAAFRRSAERIAAAPPKTRPLGPDGALLAAV
AARALALSAAPDAATARAFFEDHFLPRRIEPLGGGGGFVTGYFEPEIDGSRVRSDRFPVP
IYARPDDLVELGPDDDRTGLPDDVTWARRRPDGRLEAHPDRGAIMAGALDGRVPVLAFVA
SWVEAFFVHVQGSARVRLAEGGVLRLTFAGKSGHPYFPIARVLVERGLMEPRQATADVLR
RWLDDHPDDAPAVMARNRSFIFFREADVPDPALGPVAAAGVALTPGRSLAVDRHLVTFHA
PVFVDAAFGDDVPGAEPAFRRLMIAQDTGSAILGPARGDVFFGTGEAAWRAAARVRHPAR
FTLLVPRGDLVRVP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggccgcccccgcccgtccggcccggctgcgcgccgtcggcttcgcgcgcctgcccggc
tgggccgcggacgaccacgccgccgccttcgccgccttccgccgctccgccgaacgcatc
gccgccgcgccgccgaagacgcgcccgctcgggccggacggcgcgctgctcgccgccgtc
gccgcccgcgcgctcgccctctccgcggcgcccgacgcggcgaccgcccgcgccttcttc
gaggaccatttcctgccgcgccggatcgagccgctcggcggaggcggcggcttcgtcacc
ggctatttcgagccggaaatcgacggctcccgcgtccgctccgatcgctttcccgtgccg
atctacgcccgaccggacgacctcgtcgaactcggccccgacgacgaccgcaccggcctt
cccgacgacgtcacctgggctcgccgccggcccgacgggcgcctcgaggcccatccggac
cgcggcgcgatcatggccggcgcgctcgacggccgggtgccggtgctcgccttcgtcgcc
tcctgggtcgaggccttcttcgtccatgtgcaaggctcggcccgcgtccgtctcgccgag
ggcggggtgctgcgcctgaccttcgccggcaagagcggccatccctatttcccgatcgcc
cgcgtcctggtcgagcgcggcctgatggagccgcgccaggcgactgccgacgtgctgcgc
cgttggctcgacgaccaccccgacgacgccccggcggtgatggcgcgcaaccgcagcttc
atcttcttccgcgaggccgacgttcccgaccccgcgctcggccccgtcgccgccgccggg
gtggcgctgacgccgggccgttcgctcgcggtcgaccgccatcttgtcaccttccacgcg
cccgtgttcgtcgacgccgccttcggcgacgacgtgccgggcgccgagccggccttccgc
cgcctgatgatcgcccaggacaccggttcggcgatcctcggacccgcgcgcggcgacgtc
ttcttcggcaccggcgaggcggcgtggcgcgccgccgcccgggtccgccacccggcccgt
ttcacgctgctggtgccgcgcggggatctcgtccgtgtcccgtga

DBGET integrated database retrieval system