KEGG   Pleomorphomonas sp. SM30: OHA_1_03198
Entry
OHA_1_03198       CDS       T05766                                 

Gene name
pbpG_2
Definition
(GenBank) penicillin-binding protein 2D
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
pleo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_03198 (pbpG_2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OHA_1_03198 (pbpG_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pleo01003]
    OHA_1_03198 (pbpG_2)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03198 (pbpG_2)
Enzymes [BR:pleo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     OHA_1_03198 (pbpG_2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OHA_1_03198 (pbpG_2)
Glycosyltransferases [BR:pleo01003]
 Polysaccharide
  Bacterial polysaccharide
   OHA_1_03198 (pbpG_2)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   OHA_1_03198 (pbpG_2)
SSDB
Motif
Pfam: Transgly Transpeptidase
Other DBs
NCBI-ProteinID: BBE73584
LinkDB
Position
1:3498100..3500442
AA seq 780 aa
MARSDRDRGRVEPSFGADTDGTGLRPTARDRADGTARIDPPRGADDEDGGMATTARAGRT
NARIEPRLDGPAPTRAAGDGGPRRNGGGAGPKGGGAKGAGGAKGGGGKPAGRAPRRRRGI
GLFGFLGRLFYWGVVLSIWGAVGVAGVIGYTFATLPQTDEWKVPARPPNVEIVDAAGAPI
ANRGDTGGEAVRLEQLPPYLPEAVIAIEDRRFYHHFGIDPLGLARALVTNLTAGGVVQGG
STLTQQLAKNLFLKPDRTMERKLQEVVLALWLEWRFSKDEILEMYLNRVYLGAGAYGVDG
AARAYFGKSAREVTLGEAATLAGLLKAPSRYAPSRDAKLAHDRAMTVLAAMAEEGYIDRA
AAKRAADEPPHVVAEHNTRSENYVADWVMDLLPGYLSSLSQDVVVTTTVDLSMQRAAETA
IRDALAGEAAKFRVSQGALVAIDNDGAVKALVGGRDYAASQFDRAVQARRQPGSAFKPFV
YLTAIERGYSPDHLMTDGPVSIKGWQPKNYDGDYLGPVTLRTALAKSLNTVAAQLAAEVG
PSAVANTARRLGIVSKLHENPSIALGTAEVTPLEITSAYVPFANGGYGVIPYVIDSIATK
DGKVLFRRQGEGPGRVIDARAVGVMNAMLQGVVQYGTGAKAAIAGRPVGGKTGTSQDFRD
AWFIGYVTGLTAGVWFGNDDNSPTKKATGGALTSAVWHRFMTEAVAGRPVLPLPGTDLVP
PPAPADDIAATIDGLERQGPALPGAAAPAPVEVPVAAPPETAPTEGERTLLERLFEGSSR
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggcgaggtcggatcgggatcgcggacgggtcgagccgagcttcggcgccgacacggac
ggcaccggcctccgcccgaccgcgcgcgaccgtgccgacggcaccgcccgcatcgatccg
ccccgcggggccgacgacgaggacggcgggatggcgacgacggcccgggccggacggacc
aacgcgcgcatcgagccgcgcctcgacggacccgcgccgacacgcgcggccggcgacggc
gggccgcgtcggaacggtggaggcgccggcccgaagggcggcggcgccaagggtgccggc
ggggccaagggcggcggcggcaagccggccgggcgggcgccgcggcgacggcgcgggatc
ggcctgttcggattcctcggccggttgttctactggggcgtggtgctgtcgatctggggc
gcggtcggcgtcgccggcgtgatcggctacaccttcgcgacgctgccgcagaccgacgag
tggaaagttccggcgcgcccgcccaacgtcgagatcgtcgacgcagccggcgcaccgatc
gccaaccgcggcgacaccggcggcgaggcggtgcggctcgagcagctgccgccctacctg
cccgaggcggtgatcgcgatcgaggaccgccgcttctaccaccatttcggcatcgacccg
ctcggcctcgcccgcgcgctcgtcaccaacctgaccgccggcggcgtggtccagggcggc
tcgacgctgacgcagcagctcgccaagaacctgttcctgaaaccggaccgcaccatggag
cgcaagctccaggaggtggtgctggcgctgtggctggaatggcgcttctccaaggacgag
atcctggagatgtatctcaaccgcgtctacctcggtgccggcgcctatggcgtcgacggc
gcggcgcgggcctatttcggcaagtcggcgcgcgaggtcacgctcggcgaggcggcgacg
ctggcgggcctcctgaaggcgccgtcgcgctacgcgccgagccgcgacgccaagctcgcc
cacgaccgcgccatgaccgtgctcgccgcgatggccgaggagggctacatcgaccgcgcc
gcggcgaagcgcgccgccgacgagccgccgcacgtcgtcgccgagcacaacacccgctcg
gagaactacgtcgccgactgggtgatggacctgctgccgggctacctgtcgtcgctgtcg
caggacgtggtggtgacgaccaccgtcgacctttctatgcagcgcgccgccgagacggcg
atccgcgacgcgctcgccggcgaggcggcgaaattccgcgtcagccagggcgcgctggtg
gcgatcgacaacgacggcgcggtcaaggcgctggtcggcggccgcgactacgcggccagc
cagttcgaccgcgcggtgcaggcgcggcgccagccgggttcggccttcaagcccttcgtc
tacctgaccgcgatcgagcgcggctactcgcccgaccacctgatgaccgacggtccggtg
tcgatcaagggctggcagccgaagaactacgacggcgactatctgggtccggtcacgctc
cggaccgcgctcgccaagtcgctgaacacggtggcggcccagctcgccgccgaggtcggg
ccgtcggcggtcgccaacacggcgcgccggctcggcatcgtctccaagctgcacgagaat
ccctcgatcgccctcggcaccgccgaggtgacgccgctcgagatcacctcggcctacgtg
cccttcgccaacggcggctacggcgtgatcccctacgtgatcgacagcatcgccaccaag
gacggcaaggtgctgttccgccgtcagggcgagggcccgggccgggtgatcgacgcgcgg
gccgtgggggtgatgaatgcgatgctgcagggcgtggtgcaatacggcaccggcgccaag
gcggcgatcgcgggacggccggtcggcggcaagaccggcaccagccaggatttccgcgac
gcctggttcatcggctacgtcaccggcctcaccgccggcgtctggttcggcaacgacgac
aactcgccgacgaagaaggcgaccggcggcgcgctgacctcggcggtctggcaccggttc
atgaccgaggcggtggcggggcggccggtgctgccgctgcccggcaccgacctcgtgccg
ccgccggccccggccgacgacatcgccgccaccatcgacgggctggagcgccagggtccg
gcgctgcccggcgccgcggcgccggcgccggtcgaggtgccggtggccgcgccgcccgag
acggcgccgaccgagggcgaacgcacgctgctcgaacggctgttcgagggatcgtcgcgc
tga

DBGET integrated database retrieval system