KEGG   Pleomorphomonas sp. SM30: OHA_1_03210
Entry
OHA_1_03210       CDS       T05766                                 

Definition
(GenBank) undecaprenyl pyrophosphate phosphatase
  KO
K19302  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_03210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03210
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     OHA_1_03210
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Diphosphatase
   OHA_1_03210
SSDB
Motif
Pfam: PAP2 PAP2_3 PAP2_C DUF1118 TraG_N
Other DBs
NCBI-ProteinID: BBE73596
LinkDB
Position
1:3514137..3514886
AA seq 249 aa
MTSASDPHPGRGAPRGLRRLTLRVRREGRLLAAGFVLTLSAWLFVAIADEVAEGDTGAFD
RTLLLALRNPADPTDPIGPAWLEIAARDLTTLGGFAVIGLITTVAVAFLLLTGRKGAAGL
TVLSIGGGTLLSTALKQWFDRPRPDLVPHVVDVYTTSFPSGHATMTAIAYLTLGALLMRV
LPERRLKAFAMGTAVAIVLIVGASRVYLGVHWPTDVLAGWAVGFAWAAAWWLVVALLQRR
GRIDSDRAE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacctccgccagcgatccccaccccggccgcggtgccccgcgcggcctccgccgcctc
accctccgcgtccgccgcgagggccgcctgctcgccgccggcttcgtgctgacgctgtcg
gcctggctgttcgtggcgatcgccgacgaggtcgccgagggcgacaccggcgccttcgac
cgcacgctgctgctcgccctgcgcaatccggccgacccgaccgatccgatcggcccggcc
tggctggagatcgccgcgcgcgacctcaccaccctcggcggcttcgccgtgatcggcctg
atcaccacggtcgcggtcgccttcctgctcctgaccgggcgcaagggcgcggcggggctg
accgtgctgtcgatcggcggcggcacgctgctgtcgacggcgctgaagcagtggttcgac
cggccgcggcccgacctcgtgccacacgtggtcgacgtctacaccacgagttttccgagc
ggccacgccaccatgaccgcgatcgcctatctcaccctcggcgcgctcctgatgcgcgtg
ctgccggagcgccggctcaaggccttcgccatgggcaccgcggtcgccatcgtgctgatc
gtcggggcgagccgggtctatctcggcgtccactggccgaccgacgtgctggccggctgg
gccgtcggcttcgcctgggcggcggcgtggtggctggtggtggcgctgctgcagcggcgc
ggccggatcgattccgaccgcgcggagtga

KEGG   Pleomorphomonas sp. SM30: OHA_1_03314
Entry
OHA_1_03314       CDS       T05766                                 

Gene name
uppP
Definition
(GenBank) undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_03314 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03314 (uppP)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     OHA_1_03314 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Diphosphatase
   OHA_1_03314 (uppP)
SSDB
Motif
Pfam: BacA
Other DBs
NCBI-ProteinID: BBE73699
LinkDB
Position
1:complement(3618824..3619630)
AA seq 268 aa
MDWLLLLKALVLGFVEGLTEFIPVSSTGHLLLLGHFLGFKSTGRTFEVLIQLGAILAILA
VYADRLWQIAMALPSEPLARRFVLGVLVAFFPAVIVGVIAHDFIKTVLFETPALVCTTLI
LGGIVLLVIDRRPPAVRFKDPTRYPWTTYLAIGLFQCLAMVPGVSRSGSTIVGAMLLGVS
KRSAAEFSFYLAMPTMAGAFAYDLYKNRDALSMDDAATIGVGFLAAFVAALLVVRALLDF
VGRHGYAPFGWWRIAVGTAGLAGLWLVG
NT seq 807 nt   +upstreamnt  +downstreamnt
atggattggttgctgctgctgaaggccctggtgctcggcttcgtcgaggggctgaccgag
ttcatcccggtgtcctccaccggccacctgctgctgctcggccatttcctcggcttcaag
tcgaccggccgcaccttcgaggtgctgatccagctcggcgccatcctcgccatcctcgcc
gtctacgccgaccggctctggcagatcgccatggcgctgccatccgagccgctcgcccgc
cgcttcgtgctcggcgtgctggtcgccttcttcccggcggtgatcgtcggcgtgatcgcc
cacgacttcatcaagaccgtgctgttcgagaccccggcgctggtctgcaccacgctgatc
ctcggcggtatcgtgctgctggtgatcgaccgccggccgccggccgtccgcttcaaggac
ccgacgcgctatccctggacgacctatctcgccatcggcctgttccagtgcctcgccatg
gtgccgggcgtgtcgcgctcgggctcgaccatcgtcggcgccatgctgctcggcgtctcc
aagcgctcggccgccgagttctcgttctacctcgccatgcccaccatggccggcgccttc
gcctacgacctctacaagaaccgcgacgcgctctcgatggacgacgccgccaccatcggc
gtcggcttcctcgccgccttcgtcgctgcgctcctggtggtgcgcgccctgctcgacttc
gtcggccgccacggctacgccccgttcggctggtggcgcatcgccgtcggcaccgccggc
ctcgccgggctctggctggtcggctga

DBGET integrated database retrieval system