KEGG   Pleomorphomonas sp. SM30: OHA_1_03414Help
Entry
OHA_1_03414       CDS       T05766                                 

Gene name
glpD_1
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00564  Glycerophospholipid metabolism
pleo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OHA_1_03414 (glpD_1)
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OHA_1_03414 (glpD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BBE73798
UniProt: A0A2Z6I5H8
LinkDB All DBs
Position
1:3737925..3739442
Genome map
AA seq 505 aa AA seqDB search
MADVDVLIVGGGINGCGVARDAVGRGYSVLLAEQNDLASGTSSWSTKLIHGGLRYLEHYE
FRLVREALQEREVLWRLAPHIIRPLRFVLPHHRGLRPAWLLRLGLFLYDHLGGRKLLPPT
RTLDLSRDETGRPLKPGFFTRGFEYSDCWVEDTRLVVLNARDAADRGATILTRTRVATLA
REGDVWRAVLEDRATGARRVVTAKMVVNAAGPWVDEVLRGPLGRNDARNVRLVQGSHIVV
KRVFDHDRAYIFQNADGRIIFAIPYEGSFTLIGTTDRDWTGDPADVAITDGEIDYLLAAA
GEYFAKPIGRSDIVWSYSGVRPLYDDGASKAQEATRDYVLKVDGADGAPRLVNVFGGKIT
TYRRLAESVLEKIEEALGRRGKGSWTGGAALPGGDFLVEGFEALVAELGAAHPGVTPALV
RRLARAYGTEARRILAGARADADLGRGFGAGLTEAEVRHLVEREWARTADDVLWRRSKLG
LTLPAEGRAALEEFLGDARLGVAAQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtggacgttctcatcgtcgggggcgggatcaacggatgcggcgtcgcgcgc
gacgccgtcggccgcggctacagcgtgctgctggccgagcagaacgacctcgcctccggc
acctcgtcgtggtcgaccaagctgatccacggcggcctgcgctacctcgagcactacgag
ttccgtctggtgcgcgaggcgctgcaggagcgcgaggtgctgtggcggctcgccccgcac
atcatccgtcccctgcgtttcgtgctgccgcaccaccgcggccttcggccggcctggctg
ctgcgcctcggcctcttcctctacgaccacctcggcggtcgcaagctgctgccgccgacg
cgcacgctcgacctttcgcgcgacgagaccggccggccgctgaagccgggcttcttcacc
cggggcttcgaatactccgactgctgggtcgaggacacccgactcgtggtgctcaacgcc
cgcgacgcggccgaccgcggcgcgaccatcctgacccgcacccgcgtcgccacgctggcg
cgcgaaggcgacgtctggcgcgccgtgctcgaggaccgcgccaccggtgcccgccgcgtc
gtgaccgcgaagatggtggtcaacgccgccggaccgtgggtcgacgaggtgttgcgcggt
ccgctcggccgcaacgacgcccgcaacgtgcgcctcgtccagggctcgcacatcgtggtg
aagcgcgtgttcgatcacgaccgcgcctacatcttccagaacgccgacggtcgcatcatc
ttcgcgatcccctacgagggcagcttcacgctgatcggcaccaccgaccgcgactggacc
ggcgaccccgccgacgtcgcgatcaccgacggcgagatcgactatctgctcgcggcggcc
ggtgaatatttcgccaagccgatcggccggtccgacatcgtctggtcctattccggcgtg
cggccgctctacgacgacggcgcctcgaaggcgcaggaggcgacgcgcgactacgtgctg
aaggtcgacggcgccgacggcgcgccgcgtctcgtcaacgttttcggcggcaagatcacc
acctatcgccggctcgccgagagcgtgctggagaagatcgaggaggcgctcgggcgccgc
ggcaagggatcctggaccggcggcgccgcgctgcccggcggcgacttcctggtcgagggt
ttcgaggcgctggtggccgaactcggcgcggcccatccgggcgtgacgccggcgctggtg
cgtcggctggcgcgggcctacggtaccgaggcccgccgcatcctcgccggcgcgcgcgcc
gacgccgacctcggccgcggcttcggcgccggcctgacggaggcggaggtgcgccatctc
gtcgagcgcgaatgggcgcgcacggcggacgacgtgctgtggcgccgctccaagctcggc
ctgacgctgccggccgaggggcgggcggcgctggaggaattcctgggcgacgcccgtctc
ggcgtggcggcgcagtag

DBGET integrated database retrieval system