KEGG   Pleomorphomonas sp. SM30: OHA_1_03509
Entry
OHA_1_03509       CDS       T05766                                 

Gene name
mltB_4
Definition
(GenBank) membrane-bound lytic murein transglycosylase B precursor
  KO
K08305  membrane-bound lytic murein transglycosylase B [EC:4.2.2.-]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03509 (mltB_4)
Enzymes [BR:pleo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     OHA_1_03509 (mltB_4)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   OHA_1_03509 (mltB_4)
SSDB
Motif
Pfam: SLT_2 PG_binding_1 PG_binding_3 PG_binding_2
Other DBs
NCBI-ProteinID: BBE73887
LinkDB
Position
1:3845710..3846999
AA seq 429 aa
MTTIPRPVARILAAVLVAGSLAACGSLGGLAEFEGPRVATGEPPRNDGTPVPESFTAFVE
NFRATAEGAGVSRAVYDAAFRDIGPDQDVLDKARSQAEFVKPIWEYLDGAVSDSRVATGR
QMLATYAGVLDQIEARTGVQRQVVLAVWGMESSYGAVLDNPRVVKNAVRALATLAWGGGS
RAKYGRQQLLAVLKILQRGDTDPRHITGSWAGAMGHTQFIPTTYLAYAVDFDGDGRRDIW
RSVPDALASTANYLQKAGWRSGQAWGYEVALPAGFDSRRAGARMTLREWAALGVQRVDGS
GFPRPDDVGRLNMPAGAAGPAFLTLRNFDVIKRYNNADAYAFGVGHLSDRIAGGGPFVGR
WPWTYEPLSEVEKQEMQALLARRGYDVGGVDGKMGPATLDAIRAYQAAVGLPVDGNPSKA
VLDKLRAGA
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacgaccatcccccgccccgtcgcccggatcctggccgccgttctggtcgccggttcg
ctggccgcctgcggctcgctcggcgggctcgccgagttcgaggggccgcgcgtcgccacc
ggcgagccgccgcgcaacgacggcaccccggtgccggagagcttcacggccttcgtggag
aatttccgtgccaccgccgagggcgccggcgtctcgcgggcggtctacgacgccgccttc
cgcgacatcggccccgaccaggacgtgctcgacaaggcgcgctcgcaggccgagttcgtc
aagccgatctgggagtatctcgacggcgccgtctccgacagccgggtggcgaccgggcgg
cagatgctggcgacctatgccggcgtgctcgaccagatcgaggcgcgcaccggcgtgcag
cgtcaggtcgtgctggcggtctggggcatggagagcagctacggcgcggtgctcgacaat
ccgcgcgtggtcaagaacgcggtccgggcgctggcgacgctcgcctggggcggcggctcg
cgcgcgaaatacggccgccagcagctgctcgcggtgctgaagatcctgcagcgcggcgac
accgacccgcgccacatcaccggctcctgggcgggggcgatgggccacacccagttcatc
ccgaccacctatctcgcctacgccgtcgacttcgacggcgacggccgccgcgacatctgg
cgctcggtgcccgacgcgctcgcctcgaccgccaactatctccagaaggccggctggcgc
tcaggacaggcctggggctacgaggtcgcgctgccggccggcttcgacagccgccgcgcc
ggtgcgcggatgacgctgcgcgaatgggcggcgctcggcgtccagcgtgtcgacggctcg
ggcttcccgcggccggacgacgtcgggcgcctgaacatgccggcgggtgccgccgggccg
gccttcctgacgctgcgcaatttcgacgtcatcaagcgctacaacaacgccgacgcctac
gccttcggtgtcggccacctctccgatcgcatcgccggcggcggtccgttcgtcggccgc
tggccgtggacctacgagccgctgagcgaggtggagaagcaggagatgcaggcgctgctc
gcccgccgcggctacgacgtcggcggcgtcgacggcaagatggggccggcgacgctcgac
gcgatccgcgcctatcaggccgcggtcgggctgccggtggacggcaacccctccaaggcc
gtattggacaagctgagggcgggggcctga

DBGET integrated database retrieval system