KEGG   Pleomorphomonas sp. SM30: OHA_1_03607
Entry
OHA_1_03607       CDS       T05766                                 

Gene name
mepA_2
Definition
(GenBank) penicillin-insensitive murein endopeptidase precursor
  KO
K07261  penicillin-insensitive murein DD-endopeptidase [EC:3.4.24.-]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pleo01002]
    OHA_1_03607 (mepA_2)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03607 (mepA_2)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     OHA_1_03607 (mepA_2)
Peptidases and inhibitors [BR:pleo01002]
 Metallo peptidases
  Family M74
   OHA_1_03607 (mepA_2)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   OHA_1_03607 (mepA_2)
SSDB
Motif
Pfam: Peptidase_M74
Other DBs
NCBI-ProteinID: BBE73981
LinkDB
Position
1:complement(3955471..3956334)
AA seq 287 aa
MSRTIPAVALALGLAATGAAQADDTPAKQLFGAARTPAAMEVRSIGSYARGCLAGAIALP
VNGPSWQVMRLSRNRNWGTPLLVDFLERLATAAPKVGWNGLLVGDIAQPRGGPMLTGHAS
HQIGLDADIWLTPMPDRTLTVEERETMSATSMLGPDGKSVDPKIFGKRQLAILKLAASQP
EVARIFVNPAIKKALCERASGDRGWLRTVRPWWGHDFHFHVRLQCPASDPACKPQDPPPP
GDGCGAELDGWFKPPEEPTKPAKPAKPKPPLALKDLPPACSQVLLAP
NT seq 864 nt   +upstreamnt  +downstreamnt
atgtcgaggacgatcccggccgtggcgctcgcgctcggcctcgccgccaccggcgccgcg
caggccgacgacacgcccgccaagcagctgttcggggcggcgcgcacgccggccgccatg
gaggtgcgctcgatcggctcctacgcccgcggctgtctcgccggcgcgatcgcattgccg
gtcaacggcccgagctggcaggtgatgcggctgtcgcgcaaccgcaactggggcacgccc
ctgttggtcgacttcctggagcgcctcgccaccgcggccccgaaggtcggctggaacggc
ctcctggtcggcgacatcgcccagccgcgcggcggcccgatgctgaccggccacgccagc
caccagatcggcctcgacgccgacatttggctgacgccgatgcccgaccgcaccctcacc
gtcgaggagcgcgagaccatgagcgcgacatcgatgctcggccccgacggcaagtcggtc
gatccgaagatcttcggcaagcgccagctggcgatcctgaagctcgccgcctcccagccc
gaggtcgcgcgcatcttcgtcaacccggcgatcaagaaggcgctgtgcgaacgcgcctcc
ggcgaccgcggctggctgcgtacggtgcggccgtggtggggccacgacttccacttccac
gtccgcctgcagtgccccgccagtgatccggcctgcaagccgcaggatccgccgccgccg
ggcgacggctgcggcgccgaactcgacggctggttcaagccgccggaggagccgaccaag
ccggcgaagcccgccaagccgaagccgccgctggcgctgaaggacctgccgccggcctgc
tcgcaggtgctgctggcgccctga

DBGET integrated database retrieval system