KEGG   Pleomorphomonas sp. SM30: OHA_1_03668
Entry
OHA_1_03668       CDS       T05766                                 

Definition
(GenBank) murein L,D-transpeptidase
  KO
K21470  L,D-transpeptidase YcbB
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pleo01002]
    OHA_1_03668
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03668
Peptidases and inhibitors [BR:pleo01002]
 Cysteine peptidases
  Family C82
   OHA_1_03668
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  Transpeptidase
   OHA_1_03668
SSDB
Motif
Pfam: YkuD PG_binding_1 TraI_2_C
Other DBs
NCBI-ProteinID: BBE74042
LinkDB
Position
1:4024929..4026743
AA seq 604 aa
MQALKRRLMALALASGTALSPFAATLVHAQDQSVQDPFAVEPVDPSPAVVDPAAAAAPVA
TEAAPVAEALPPAAADSGAAALRALLTAPDALAGVAAKDRAAILAWYGARAFEPMWVADG
RLTERADAVVARIARAAEDGLDPSAYALPDAAALVGATPDRLAAVDVGLTAAVARFAREA
SGGRVSPQKISKDITRTPPAIDARTALATVEAATDVAAALDGFDPPHEEFRRLKAKLAEV
RARQETPVAHAPIAEGPTLKPGMRDARVPALRERFGIPAPELVTGSLPETQTASNGDDEL
VATVEAALASSTDEVYDQPLIDAVKSFQAENGLTADGIVGARTLSVLNGGPRDEEGEIVA
NMEMWRWMPRDLGRDHVFVNVPEFMVHVVRDGVRIHETRVVVGKVTNQTPIFSDEMEYLV
VNPYWNVPESIKIKEMLPAIKADPAGYMARHGYEVVWEGQVIDPATVVWDENAVKAVGIR
QTPGEANALGHIKFMFPNQHAVYLHDTPSRALFQRDVRAFSHGCVRVDDPTAFAGAVLQG
DPEWTVERVESLYGGPERRVNLAHHLKVHIAYFTASVDDTGKLTLRDDLYGHVRKLKAAL
GVST
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgcaggccttgaagcggcgcctgatggcgctggcactcgcctccggaacggcgctgtcc
ccgttcgcggcgactctcgtccacgcccaggaccagtccgtgcaggatccgttcgcggtc
gagccggtcgatccgtcccccgccgtggtcgatcccgcggccgccgccgcgccggtcgcg
actgaggccgccccggtcgccgaggctctgccgccggcggccgccgattcgggcgccgcg
gccctgcgcgccctcctgaccgcgcccgatgcgctcgccggcgtcgccgccaaggaccgt
gccgccatcctcgcgtggtacggcgcgcgcgccttcgagccgatgtgggtcgccgacggc
cggctgaccgagcgcgccgacgccgtcgtcgcccggatcgcccgcgccgccgaggacgga
ctcgacccctccgcctacgcgctgcccgacgccgccgccctcgtcggcgcgacgccggac
cggctcgccgccgtcgacgtgggcctcaccgcggcggtcgcccgcttcgcccgcgaggcc
tccggcggacgggtctcgccgcagaagatctccaaggacatcacccggacgccgccggcg
atcgacgcgcgcaccgcgctcgccaccgtcgaggccgcgaccgacgtcgccgccgcgctc
gacggtttcgatccgccgcacgaggaattccgccggctgaaggccaagctcgccgaggtc
cgcgcccgccaggagacgccggtcgcccacgcgccgatcgccgaggggccgacgctgaag
cccggcatgcgcgacgcccgcgtgccggcgctgcgcgagcgcttcggcatcccggcgccg
gagctcgtcaccggcagcctgccggaaacgcagacggcctccaacggcgacgacgagctg
gtggccaccgtcgaggccgcgctggcctcctccaccgacgaggtctacgaccagccgctg
atcgacgcggtcaagtcgttccaggccgagaacggcctgaccgccgacggcatcgtcggt
gcgcgcacgctgtcggtcctgaacggcggcccgcgcgacgaggagggcgagatcgtcgcc
aacatggagatgtggcgctggatgccgcgcgacctcggtcgcgaccacgtcttcgtcaac
gtgccggagttcatggtccacgtcgtgcgcgacggcgtgcggatccacgagacccgcgtg
gtcgtcggcaaggtgaccaaccagacgccgatcttctccgacgagatggagtatctcgtc
gtcaatccctattggaacgtgccggaatccatcaagatcaaggagatgctccccgcgatc
aaggcggatccggccggctacatggcccggcacggttacgaggtcgtctgggagggccag
gtgatcgatccggccaccgtggtgtgggacgagaatgcggtgaaggcggtcggcatccgc
cagacgccgggcgaggccaacgccctcggccacatcaagttcatgttccccaaccagcac
gcggtctacctgcacgacacgccgtcgcgggcgctgttccagcgcgacgtccgtgccttc
agccacggctgcgtccgcgtcgacgatcccaccgccttcgccggtgccgtcctgcagggc
gatccggagtggactgtcgagcgggttgaatcgctctacggcggcccggagcgccgggtg
aacctcgcccatcacctgaaggtccacatcgcctatttcaccgcctccgtcgacgacacc
ggcaagctgaccctgcgcgacgacctctacggccacgtccgcaagctcaaggccgcgctc
ggcgtctcgacctga

DBGET integrated database retrieval system