KEGG   Pleomorphomonas sp. SM30: OHA_1_03839
Entry
OHA_1_03839       CDS       T05766                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00520  Amino sugar and nucleotide sugar metabolism
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OHA_1_03839 (murA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_03839 (murA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_03839 (murA)
Enzymes [BR:pleo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     OHA_1_03839 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   OHA_1_03839 (murA)
SSDB
Motif
Pfam: EPSP_synthase HeH
Other DBs
NCBI-ProteinID: BBE74210
LinkDB
Position
1:4203692..4205083
AA seq 463 aa
MGTTAAADAREGRAGRPADEGRRGRPRRRNGVTRMDKIRIVGGNRLNGTIPISGAKNAAL
PLMIASLLTDETLTLENVPRLADVNGLQRILVNHGVDYAVNGKRPGEDALAGQTVSLTAR
SITDTTAPYELVSKMRASFWVIGPLLARMRECRVSLPGGCAIGTRPVDLFLMGLERLGAQ
IDVDGGYVVARAPNGLVGGRIVFPKVSVGATHTLMMAAALAKGETVIENAAREPEVVDLA
RCLTAMGAEIEGAGSETIRIQGVDRLRGARHKVVSDRIEAGTYAMAVAMTGGDVLLENAE
ADLLGEPIEVLRRVGAEIVETNRGLQVRRNGHGIVATDVETQPFPGFPTDLQAQFMALMT
MAKGTSRITETIFENRFMHVAELARFGARIQLDGQVATVEGVERLRGAPVMATDLRASVS
LVIAGLAAEGETMVNRVYHLDRGFERLEDKIGRCGAVIERIAG
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggaacgacagccgcggccgacgcccgagaggggcgggccggacggccggcggacgag
ggacggcgcggccgtccgcgccgccgcaacggggtgacacggatggacaagatcaggatc
gtcggcggcaacaggctgaacggcaccattccgatttccggcgccaagaacgccgcgctg
ccgctgatgatcgccagcctgctgaccgacgagacgctgacgctcgagaacgtgccccgg
ctcgccgacgtcaacggcctgcagcgcatcctggtcaaccacggcgtcgactacgcggtg
aacggcaagcgccccggcgaggacgcactcgcgggccagaccgtgagcctgaccgcccgc
tcgatcaccgacaccaccgcgccctacgagctggtctcgaagatgcgcgccagcttctgg
gtgatcggccccctgctcgcccgcatgcgcgagtgccgggtgtcgctgccgggcggctgc
gccatcggcacccggccggtcgacctgttcctgatgggtctcgagcgcctcggcgcgcag
atcgacgtcgacggcggttacgtggtggcgcgggcgccgaacggcctcgtcggcggccgg
atcgtgttcccgaaggtctcggtcggcgccacccacacgctgatgatggccgccgccctc
gccaagggcgagaccgtgatcgagaacgccgcccgcgagcccgaggtggtcgacctagcc
cgctgcctgaccgccatgggcgcagagatcgagggcgccggctccgagacgatccggatc
cagggcgtcgaccgcctgcgcggcgcccgccacaaggtggtgtcggaccgcatcgaggcc
ggcacctacgccatggccgtggcgatgaccggcggcgacgtgctgctcgagaacgccgag
gccgacctgctgggcgagccgatcgaggtgctgcgccgggtcggcgccgagatcgtcgag
accaaccgcggcctccaggtccgccgcaacggccacggcatcgtggcgacagacgtcgag
acccagccgttcccgggcttcccgaccgacctccaggcccagttcatggcgctgatgacc
atggccaagggcacctcgcggatcaccgagaccatcttcgagaaccgcttcatgcacgtg
gcggaactcgcccgcttcggcgcgcgcatccagctcgacggccaggtggcgaccgtcgag
ggggtcgagcgcctgcgcggcgccccggtgatggcgaccgacctgcgcgcctctgtgtca
ctggtgatcgccggcctcgccgccgagggcgagaccatggtcaaccgcgtctaccacctc
gaccgcggcttcgagcgcctcgaggacaagatcggccgctgcggcgcggtgatcgagcgc
atcgcgggctga

DBGET integrated database retrieval system