KEGG   Pleomorphomonas sp. SM30: OHA_1_04023Help
Entry
OHA_1_04023       CDS       T05766                                 

Gene name
gutB_1
Definition
(GenBank) sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OHA_1_04023 (gutB_1)
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OHA_1_04023 (gutB_1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OHA_1_04023 (gutB_1)
    1.1.1.-  
     OHA_1_04023 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BBE74392
UniProt: A0A2Z6I485
LinkDB All DBs
Position
1:complement(4400269..4401303)
Genome map
AA seq 344 aa AA seqDB search
MRAAIFDTVGRPLRIGDVPEPRPGADEVVLRVSACGICGSDLHITEDPAPFGIGAGFVLG
HEFAGEIVETGTDVGDLAVGDRVAVVPMRGCGRCAACRRGDPGRCPEMTLIGGGYAEHVA
VAARQCVRLPDGVDTADGALAEPLAVALHCIVRSGMKPGDRVAILGAGPIGLLVAFWARR
MGAAAVVVADLHDHQCDRALALGATAFAISDGRLAERLADACGGAPDIVFECVGKRGLIA
AAVGAVRLQGTVVGVGLCIGGDEWDPFVALSKEVNLLFSVFFHQGNEFAVALDALAATPF
RPQALVTDTIGLGQVPQVFEGLRRRTTQCKVLIRPDLDRGDATT
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggccatcttcgacaccgtcgggcgccccttgcggatcggcgacgtgccggaa
ccgcgccccggcgcggacgaggtggtgctgcgcgtttcggcctgcggcatctgcggcagc
gacctgcacatcaccgaggatcccgcacccttcggcatcggcgcgggcttcgtgctcggc
cacgagttcgccggcgagatcgtcgagaccggcacggacgtcggcgacctcgccgtcggc
gatcgcgtcgccgtggtgccgatgcgcggctgcggccgctgcgcggcgtgccggcgtggc
gatcccggccgctgccccgagatgacgctgatcggcggcggctatgcggaacacgtcgcc
gtcgccgcccgccagtgcgtgcgcctgccggacggcgtcgacaccgccgacggcgcgctc
gccgagccgctcgccgtggcgctccactgcatcgtccgctccggtatgaagcccggcgac
cgcgtcgcgatcctcggcgccgggccgatcggcctgctggtcgccttctgggcgcgccgg
atgggcgcggcggcggtcgtcgtcgccgacctccacgatcaccagtgcgaccgcgcgctg
gcgctcggcgccaccgccttcgcgatctccgacggacggctcgccgaacggctcgcggac
gcctgcggcggcgccccggacatcgtgttcgagtgcgtcggcaagcgcggcctgatcgcg
gcggcggtcggcgcggtgcggctgcagggcaccgtggtcggcgtcggcctctgcatcggc
ggcgacgagtgggatcccttcgtcgcgctgtcgaaggaggtgaacctgctgttctccgtg
ttcttccaccagggcaacgaattcgccgtggcgctcgacgcgctcgccgccacgccgttc
cggccgcaggcgctcgtcaccgacaccatcggcctcggccaggtgccgcaggtcttcgag
ggcctcaggcgccgcaccacccagtgcaaggttctgatccgacccgatctcgatcgagga
gacgcgacgacatga

DBGET integrated database retrieval system