KEGG   Pleomorphomonas sp. SM30: OHA_1_04132
Entry
OHA_1_04132       CDS       T05766                                 

Gene name
ftsI
Definition
(GenBank) peptidoglycan synthase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04132 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    OHA_1_04132 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04132 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pleo03036]
    OHA_1_04132 (ftsI)
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     OHA_1_04132 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   OHA_1_04132 (ftsI)
Chromosome and associated proteins [BR:pleo03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    OHA_1_04132 (ftsI)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2 Beta-lactamase
Other DBs
NCBI-ProteinID: BBE74501
LinkDB
Position
1:4513180..4514907
AA seq 575 aa
MPNAPSLPTASKLRALLPWRRRAVRREKPSPGDTTRSRLILAMGAFVLVYGTIGARLVQF
GLAEPADPAVLGNAQAAIAAARPDIVDRNGEILATDIKTASLYAEPRRIVDPDEATELLG
TVFPELGTDATRQKLASRQGFVWLKREITPQQQEAVHKLGLPGIGFLSESKRFYPSGRSV
GYVVGHVNIDNQGIAGIEKYIDDQWLGDLHKLGFAMTPNLEPIKLTLDLRVQHVLHDELS
SAMERYTAIGAAGVVMNVKTGEVVAMASMPDYDPNNPVEALDPNKMNRASAAVFEMGSTF
KLFATAMALDSGKVRLTDSFDASAPLRIGGFTIHDFHGKHRVLTVPEVFIYSSNVGTGKE
ALRVGQAGQQEFLRRIGLMDKVPTELPEIARPILPKRWSDLVTVTVSFGHGISVSPLATA
MSASAVMNGGLLIPPTFFPRSEEKARLMATRVLKQQTSDEMRYLMRLNVLKGSGTRANIP
GYRVGGKTGTAEKVVNGRYSANKRFNAFLASFPIDDPQYLVLVVLDEPNPEKPGVGATAG
LNAAPTASNVISRIAPMLGVMPRFDDADRPLMVSF
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgccgaacgctccctccctgccgaccgcgagcaaactgcgggcgctgctgccctggcgc
cgccgcgccgtgcgccgcgagaagccgtcgccgggcgacaccacgcgcagccggctgatc
ctggcgatgggcgccttcgtgctggtctacggcacgatcggggcacggctggtgcagttc
ggcctcgccgagccggccgacccggcagtgctcggcaacgcccaggccgcgatcgcggcg
gcgcggccggacatcgtcgaccgcaacggcgagatcctcgccaccgacatcaagaccgcc
tcgctctacgccgagccgcgccgcatcgtcgaccccgacgaggcgaccgaactgctcggc
accgtgttccccgaactcggcaccgatgcgacgcgccagaagctggcctcgcgccagggc
ttcgtctggctgaagcgcgagatcacgccgcagcagcaggaggcggtgcacaagctcggc
ctgccgggcatcggcttcctgtcggagagcaagcgcttctatccctcgggccggtcggtc
ggctacgtggtcggccacgtcaacatcgacaaccagggcatcgccgggatcgagaagtac
atcgacgaccagtggctcggcgacctgcacaagctcggcttcgcgatgacgccgaacctc
gagccgatcaagctgacgctcgacctgcgcgtccagcacgtgctgcacgacgaactgtcg
tcggcgatggagcgctacaccgcgatcggcgccgccggcgtggtgatgaacgtcaagacc
ggcgaggtggtggcgatggcctccatgccggactacgacccgaacaaccccgtcgaggcg
ctcgacccgaacaagatgaaccgggcctcggccgccgtgttcgagatgggctcgaccttc
aagctgttcgccaccgcgatggcgctcgattcgggcaaggtcaggctgaccgacagcttc
gacgcctcggcgccgctccggatcggcggcttcaccatccacgacttccatggcaagcac
cgcgtgctgacggtgcccgaggtgttcatctattcctccaacgtcggcaccggcaaggag
gcgctccgggtcgggcaggccggccagcaggagttcctgcgccgcatcggcctgatggac
aaggtgccgacggaactgccggagatcgcccgcccgatcctgccgaagcgctggtcggac
ctcgtcaccgtgaccgtctcgttcggccacggcatctcggtgtcgccgctcgccaccgcg
atgtcggcctcggcggtgatgaacggcggcctcctgatcccgccgaccttcttcccgcgt
tcggaggagaaggcgcggctgatggcgacgcgcgtcctcaagcagcagacctcggacgag
atgcgctacctgatgcgcctcaacgtgctgaagggctcgggcacgcgcgccaacatcccg
ggctaccgggtcggcggcaagaccggcacggccgagaaggtcgtcaacggccgctattcc
gccaacaagcgcttcaacgccttcctcgccagcttcccgatcgacgacccgcagtacctg
gtgctggtggtgctcgacgagccgaatccggagaagcccggcgtcggcgcgaccgccggc
ctgaacgccgcgccgaccgcgtccaacgtcatcagccgcatcgccccgatgctcggcgtc
atgccgcgcttcgacgacgccgaccggccgttgatggtctcgttctga

DBGET integrated database retrieval system