KEGG   Pleomorphomonas sp. SM30: OHA_1_04133
Entry
OHA_1_04133       CDS       T05766                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase
  KO
K15792  MurE/MurF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00300  Lysine biosynthesis
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    OHA_1_04133 (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04133 (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04133 (murE)
Enzymes [BR:pleo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     OHA_1_04133 (murE)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     OHA_1_04133 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Amino acid ligase
   OHA_1_04133 (murE)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: BBE74502
LinkDB
Position
1:4515060..4517933
AA seq 957 aa
MKLAELAPDILTPDPALRRMVITGVTADSREVRPGTLFAALPGTKVQGSAYIPQAVERGA
AVILTGSNDDVPLELPVPVLRDPDPMRRFSRLVARFYAPQPKTVVAVTGTNGKTSVAAFV
RQIWEKTGKAAASIGTIGVVAKGETRYGNMTTPDPVTLHRTLRDLRAEGIDHVAMEASSH
GLIQRRLDGLTICAGAFTNLSRDHLDYHGSMDGYMAAKMRLFDTVLEPGAGAVVNLDDRY
GEAFAAAARISGLDLMTVGAQGAAIRILDVARDGFAQVVTVDVGAGPRTVRVPLVGAFQV
SNALVAAGLAAAGGAVTLAEALDAVSSIEGAQGRLELVAHAPSGAPIFVDFAHTPAALEV
ALSTLRPYVEGKLVVAFGAGGDRDRGKRPQMGEVAERLADVAIVTDDNPRSEDPAEIRAA
ILAAAPSAIEIGDRAEAIRRGIALLGDGDVFLVAGKGHETGQIVGDTVLPFSDQETVRHS
LPEGVADDRVLWPGRSFLAGVGGTAIGALPAAITGISIDSRSVEPGDAFFAITGDRLDGH
AFVADALRRGAAVGVIAADRRGEVETDGALVAVDDVLAGLRRLAAYARLRTKAKVVAVTG
SVGKTSTKEALRAALSGSGAVHASVASFNNHWGVPLTLARMPKNVAYGVFEIGMNHAGEI
TPLTQLVRPHVAIVTNVAAVHLEHFPDEAGIARAKAEIFTGLEPGGTAIVNGDNRWAGLL
ADAAREQGATVIRFGEVADADARLIKFALHEECSAVTADILGETVSYKIGAPGRHLVDNS
LAVLAAVKLVGADLSRAMMALQRLEPPKGRGKRHTLRIGGGAATLIDESYNANPTSMRAA
IALLKQARAEGGRRIAVLGDMLELGPESPALHAGLLGPLTDAGVDRVYCAGQQMRELWKL
LPRPMRGSYAETSAGLESLVDDVRAGDVIMVKGSLGSRMGPLVEALIKRHGEPSSGR
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgaaacttgcggaactcgcccccgacatcctcacgcccgacccggcgctccggcgcatg
gtgatcaccggcgtgaccgcggacagccgcgaggtccggccgggcacgctgttcgcggcg
ctgccgggcaccaaggtccagggctccgcctacatcccgcaggcggtcgagcgcggcgcg
gcggtgatcctgaccggctcgaacgacgacgtgccgctggaactgccggtgccggtgctg
cgcgatcccgacccgatgcgccgcttttcccgcttggtcgcgcgcttctacgcgccgcag
ccgaagacggtggtggcggtgaccggcaccaacggcaagacctcggtcgccgccttcgtc
cgccagatctgggagaagaccggcaaggccgccgcctcgatcggcaccatcggcgtcgtc
gccaagggcgagacccgctacggcaacatgacgacgcccgacccggtgacgctgcaccgg
acgctgcgggacctcagggccgagggcatcgaccacgtcgcgatggaggcgtcttcgcac
gggctgatccagcgccggctcgacggcctgaccatctgcgccggcgccttcaccaacctc
tcgcgcgaccacctcgactaccacggctccatggacggctacatggccgccaagatgcgc
ctgttcgacacggtgctggagccgggcgcgggcgccgtggtcaacctcgacgaccgttac
ggcgaggccttcgccgcggcggcccggatctccggcctcgatctgatgacggtcggcgcg
cagggggcggcgatccgcatcctcgacgtcgcccgcgacggcttcgcgcaggtggtgacg
gtcgacgtcggcgcgggaccgcgcaccgtgcgggtgccgctggtcggcgccttccaggtc
tcgaacgcgctggtcgccgccggcctcgccgccgccggcggggcggtgacgctggccgag
gcgctcgacgcggtgtcctcgatcgagggcgcccagggccggctcgagctcgtcgcccac
gcgccgtccggcgcgccgatcttcgtcgacttcgcccacaccccggctgcgctcgaagtc
gcgctctcgacgctccggccctatgtcgagggcaagctggtggtcgccttcggcgccggg
ggcgaccgcgaccgcggcaagcgcccgcagatgggcgaggtggccgagcggctcgccgac
gttgccatcgtcaccgacgacaacccgcgctcggaggatccggccgagatccgcgccgcc
atcctcgccgccgcgccgtcggcgatcgagatcggcgaccgcgccgaggcgatccggcgc
ggcatcgcgctgctcggcgacggcgacgtgttcctggtcgccggcaagggccacgagacc
ggccagatcgtcggcgacaccgtgctgccgttctccgaccaggagacggtgcgccattcc
ctgcccgagggcgtggccgacgaccgcgtgctgtggccgggccgctccttcctcgccggc
gtcggtggcaccgcgatcggcgcgctgccggcggcgatcaccggtatctcgatcgacagc
cgctcggtcgagccgggcgacgccttcttcgccatcaccggcgaccggctcgacggccac
gccttcgtcgccgacgcgctgcggcgcggcgcggcggtcggcgtgatcgccgcggaccga
cgcggcgaggtcgagaccgacggcgcgctggtggcggtcgacgacgtgctcgcgggcctg
cgccgcctcgccgcctacgcccggctgcggacgaaggccaaggtggtcgcggtgaccggg
tctgtcggcaagacctcgaccaaggaggcgctgcgcgccgccctgtcgggctcgggcgcg
gtccacgcctcggtcgcctcgttcaacaaccactggggcgtgccgctgacgctcgcccgg
atgccgaagaacgtcgcctacggcgtgttcgagatcggcatgaaccacgccggcgagatc
accccgctgacccagctggtgcgcccgcacgtggcgatcgtgaccaacgtcgcggccgtg
cacctcgagcacttccccgacgaggccgggatcgcgcgcgccaaggcggagatcttcacc
gggctcgagcccggcggcaccgcgatcgtcaacggcgacaaccgctgggccggcctgctc
gccgacgccgcccgcgagcagggcgccaccgtgatccgcttcggcgaagtggcggacgcc
gacgcgaggctgatcaagttcgccctgcacgaggagtgctcggcggtgaccgccgacatc
ctcggcgagacggtgagctacaagatcggcgcgccgggccggcatctggtcgacaactcg
ctggcggtgctggccgccgtcaagctggtcggcgcggacttgagccgcgcgatgatggcg
ctgcagcggctggagccgccgaagggccgcggcaagcgccacaccctcaggatcggcggc
ggcgccgcgacgctgatcgacgagagctacaacgccaacccgacctcgatgcgggcggcg
atcgcgctcctgaagcaggcgcgcgccgagggcggccgccgcatcgcggttctcggcgac
atgctggaactcggaccggagtcgccggccctccacgccggcctgctcggtccgctcacc
gatgccggcgtcgatcgcgtgtattgcgcgggtcagcagatgcgcgaactctggaaactc
ttgccccgcccgatgcggggatcgtatgcggagacgtcggcgggcctcgaatcactggtc
gacgacgttcgcgccggcgacgtgatcatggtcaagggctcgctcggcagccgcatgggt
ccgctggtcgaggccctgatcaagcgtcacggcgaaccgtcgagcggtcgctga

DBGET integrated database retrieval system