KEGG   Pleomorphomonas sp. SM30: OHA_1_04134
Entry
OHA_1_04134       CDS       T05766                                 

Gene name
mraY
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
pleo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04134 (mraY)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OHA_1_04134 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04134 (mraY)
Enzymes [BR:pleo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     OHA_1_04134 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Glycosyltransferase
   OHA_1_04134 (mraY)
SSDB
Motif
Pfam: Glycos_transf_4 MraY_sig1
Other DBs
NCBI-ProteinID: BBE74503
LinkDB
Position
1:4517969..4519051
AA seq 360 aa
MLVYLAELAGQVSVLNVFRYITFRTGAAVMTALLFVFLFGPGIIASLRVRQGKGQPIRAD
GPQSHLTKKGTPTMGGLMILSGFLVSTLLWADLRNPYVWTVIVVTFAFGSIGFYDDYLKV
TKQSHKGFSGKARLGLEALIAGLACLVIAEAGQPHFATSLAFPFFKDVLLDLGWFFIPFG
AFVVVAAGNAVNLTDGLDGLAIVPVMIACASFGLIAYVAGNAVFASYLQIHFVAGTGELA
VICGAVLGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTIAVATKHEIVLAIIGGLFVLE
ALSVIIQVGSFKMTGKRVFKMAPIHHHFEHLGWTEAQVVIRFWIVSVVLALIGLATLKLR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgctggtctatctggccgaactggcaggtcaggtctcggtcctgaacgtgttccggtac
atcaccttccggaccggagccgcggtgatgaccgcgctgctgttcgtcttcctgttcggc
cccggcatcatcgcctccctgcgcgtgcgccagggcaagggccagccgatccgcgccgac
ggcccgcagagccacctcaccaagaagggcacgcccaccatgggcggcctgatgatcctg
tcgggcttcctggtctcgaccctgctctgggccgaccttcggaacccctacgtctggacc
gttatcgtcgtcaccttcgccttcgggtcgatcggcttctacgacgactacctcaaggtc
accaagcagtcgcacaagggcttctcgggcaaggcccggctcggcctcgaggcgctgatc
gccggcctcgcgtgcctggtgatcgccgaggcgggccagccgcatttcgcgacctcgctg
gccttcccgttcttcaaggacgtgctgctcgacctcggctggttcttcatcccgttcggc
gccttcgtggtggtggcggccggcaacgccgtgaacctcaccgacggcctcgacggcctc
gccatcgtgccggtgatgatcgcctgcgcctcgttcggcctgatcgcctacgtcgccggc
aacgcggttttcgcctcctacctgcagatccacttcgtcgccggcaccggcgagctggcg
gtgatctgcggcgccgtgctcggcgccggcctcggcttcctgtggttcaacgccccgccg
gcggcgatcttcatgggcgacaccggctcgctggcactcggcggcctgatcggcaccatc
gccgtcgccaccaagcacgagatcgtgctggcgatcatcggcggcctgttcgtgctggag
gcgctgtcggtgatcatccaggtcggctccttcaagatgaccggcaagcgcgtcttcaag
atggcgccgatccaccaccacttcgagcatctcggctggaccgaggcgcaggtggtgatc
cggttctggatcgtctcggtggtgctggcgctgatcggtctcgccaccctgaagctgcgt
tga

DBGET integrated database retrieval system