KEGG   Pleomorphomonas sp. SM30: OHA_1_04137
Entry
OHA_1_04137       CDS       T05766                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
pleo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04137 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OHA_1_04137 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04137 (murG)
Enzymes [BR:pleo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     OHA_1_04137 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Glycosyltransferase
   OHA_1_04137 (murG)
SSDB
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_transf_4 UDPGT
Other DBs
NCBI-ProteinID: BBE74506
LinkDB
Position
1:4521632..4522756
AA seq 374 aa
MGSTFLIAAGGTGGHLFPAEALAHELGRRGHVVHLATDHRATDYGRDFPAAAVHVVASAT
FGDRSPLGLARSAVRIATGQLQSLALVGRLKPAAAIGFGGYPTLPPLLAASLRGVPTVVH
EANAVMGRANRFLARRTTAVATSFATTRLLDDPAKAVTTGNPVRPRVVAAASPYDVPAAA
GPFRLVVFGGSQGARVFSELVPPALALLAPDLGARLRLVQQVRPEDMARVRAGYSELGIE
AELLSFFPDLPERIAGAHLVVCRSGASSVSELAVIGRPSILVPLPHALDADQKSNALELE
RAGGALMAEQASLTPDVLAGHLSTLMNDPGRLAAMATAARGEGRPDAVQRLADLVEHVGA
GGRPADFARGRPTP
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggctcgaccttcctgatcgccgccggcggcaccggcggccacctgttcccggccgag
gcgctcgcgcacgaactcggccgccgcggccacgtggtgcacctcgccaccgaccaccgc
gccaccgactacggccgcgacttcccggccgcggccgtgcacgtcgtcgcctccgccacc
ttcggcgaccgctcgccgctcggactcgcgcgctcggccgtgcggatcgccacgggccag
ttgcagtcgctggcactggtcggtcggctgaagccggcggccgcgatcggcttcggcggc
tatccgaccctgccgccgctgctggcggcgtcgctgcgcggcgtgccgaccgtcgtgcac
gaggccaacgcggtgatgggccgggccaaccgcttcctcgcccgccgcaccaccgcggtg
gcgacgtccttcgcgacgacgcgcctgctcgacgatcccgccaaggcggtgacgaccggc
aacccggtgcgcccgcgcgtggtcgcggccgcctccccctacgacgtgccggccgcggcc
gggccgttccgcctcgtcgtgttcggcggcagccagggcgcgcgggtgttctccgaactg
gttccgccggcgctggcgctgctcgcgcccgacctcggcgcccggctccggctggtgcag
caggtccggccggaggacatggcgcgggtgcgcgcgggctattccgagctcggcatcgaa
gccgaactgctgtccttcttccccgacctgcccgagcgcatcgccggcgcccatctggtg
gtgtgccgctccggggcgtcgtcggtgtcggaactcgccgtcatcggccggccctcgatc
ctggtgccgctgccgcacgcgctcgacgccgaccagaaatccaacgcgctcgagctggag
cgcgccggcggcgcgctgatggccgagcaggcgagcctgacgcccgacgtgctcgccggc
cacctctccaccctgatgaacgaccccggccggctcgccgccatggccaccgccgcgcgc
ggcgagggacggcccgacgcggtgcagcgtctcgccgacctcgtcgagcacgtcggcgcc
ggcggccgccccgccgacttcgcccgaggacgcccgaccccatga

DBGET integrated database retrieval system