KEGG   Pleomorphomonas sp. SM30: OHA_1_04138
Entry
OHA_1_04138       CDS       T05766                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate-L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00471  D-Glutamine and D-glutamate metabolism
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    OHA_1_04138 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04138 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04138 (murC)
Enzymes [BR:pleo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     OHA_1_04138 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Amino acid ligase
   OHA_1_04138 (murC)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C DELLA
Other DBs
NCBI-ProteinID: BBE74507
LinkDB
Position
1:4522753..4524177
AA seq 474 aa
MKMPHDIGPVHFVGIGGIGMSGIAEVLNNLGYRVQGSDVAEGYNLERLRKAGIAVTVGHK
AENLGLAEVVVVSSAIKRDNPELVAARERHLAIVRRAEMLAELMRFKQAIAIGGTHGKTT
TTSMVAALLDAGGLDPTVINGGIINAYGTNARMGAGDWMVVEADESDGTFVKLPADVAIV
TNIDPEHLDHYGSFDNARAAFKQFVENVPFYGFAVMCLDHPEVQALVSRIEDRRILTYGA
NPQADVRFTDLRFESGASRFSVEIRNRITGTSEIIQALELPMPGRHNVSNATAAVAVARQ
LGIPADAIRRGLAAFGGVKRRFTRTGVWNGVTVYDDYGHHPVEIMAVLRAARESATGRVV
AVVQPHRYSRLASLFADFCKCFNDADTVFVADVYAAGEQPIEGADKASLVAGTKAAGHRD
ARVLEGPETLAAQVIGTVGPGDIVVCLGAGSITTWAYALPKQLSELSVSRGGPA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaagatgccccacgacatcggccccgtgcatttcgtcggcatcggcggcatcggcatg
agcggcatcgccgaggtgctgaacaacctcggctaccgcgtccagggttcggacgtcgcc
gagggctacaacctcgagcgcctgcgcaaggccggcatcgccgtcaccgtcggccacaag
gccgagaatctcggcctcgccgaggtggtggtggtgtcctcggcgatcaagcgcgacaat
cccgaactggtcgcggcgcgcgagcgccacctcgccatcgtgcggcgcgccgagatgctg
gccgagctgatgcgcttcaagcaggcgatcgcgatcggcggcacccacggcaagacgacc
acgacctcgatggtggccgcgctgctcgacgccggcgggctcgacccgaccgtgatcaac
ggcggcatcatcaacgcctacggcaccaacgcccgcatgggcgccggcgactggatggtg
gtggaggccgacgagagcgacggcaccttcgtcaagctgccggccgacgtcgccatcgtc
accaacatcgaccccgagcacctcgaccactacggctcgttcgacaacgcccgcgccgcc
ttcaagcagttcgtcgagaacgtgcccttctacggcttcgcggtgatgtgcctcgaccat
cccgaggtgcaggcgctggtcagccggatcgaggaccgccgcatcctgacctacggcgcc
aacccgcaggccgacgtgcgcttcaccgacctgcgcttcgagagcggggcgtcgcgcttc
tcggtggagatccgcaaccgcatcaccggcacctcggagatcatccaggcgctggaactg
ccgatgccgggccgccacaacgtctccaacgccaccgccgcggtggcggtggcgcgccag
ctcggcattcccgccgacgcgatccggcgcggcctcgccgccttcggcggcgtcaagcgc
cgcttcacccgcaccggcgtctggaacggcgtcaccgtctacgacgactacggccaccac
ccggtcgagatcatggcggtgctgagggccgcgcgcgagagcgccacggggcgcgtggtc
gccgtggtgcagccgcaccgctacagccgcctcgccagcctgttcgccgacttctgcaag
tgcttcaacgacgccgacacggtgttcgtcgccgacgtctacgccgccggcgagcagccg
atcgagggggccgacaaggcctcgctggtcgccggcaccaaggcggccggccaccgcgac
gcgcgcgtgctcgaggggccggagacgctggccgcgcaggtgatcggcacggtcggaccc
ggcgacatcgtggtctgcctcggcgccggcagcatcaccacctgggcctacgccctgccg
aagcagctctccgaactgtcggtctcgcgcgggggaccggcatga

DBGET integrated database retrieval system