KEGG   Pleomorphomonas sp. SM30: OHA_1_04139
Entry
OHA_1_04139       CDS       T05766                                 

Gene name
murB
Definition
(GenBank) UDP-N-acetylenolpyruvoylglucosamine reductase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00520  Amino sugar and nucleotide sugar metabolism
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    OHA_1_04139 (murB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04139 (murB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04139 (murB)
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     OHA_1_04139 (murB)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   OHA_1_04139 (murB)
SSDB
Motif
Pfam: MurB_C FAD_binding_4
Other DBs
NCBI-ProteinID: BBE74508
LinkDB
Position
1:4524174..4525127
AA seq 317 aa
MNGAALIARLGDLSAIRGRIEPERALKDLVWFRAGGPAEVLYQPADEDDLRAFLPKVPAD
VPVTVIGLGSNLIVRDGGVPGVVIRLSVRGFGGVERLGATRLKVGAGVPDKHLAATALDA
GLSGFAFYHGIPGGIGGALRMNAGAHGAETRERVVEVRAVTRAGEAVTLSNEGMGYSYRH
SDAPAELIFTAAVYEGVPAERDAIRAEMDAVQEHREKSQPIRSRTGGSTFKNPPGHSAWK
LVDAAGCRGLRIGDAEVSQMHCNFLINTDAASAHDIELLGETVRARVLETSGVRLEWEIK
RLGVFEPGRAVEPFLGR
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaacggcgcggcgctgatcgcgcggctcggcgacctctcggccatccgcggtcggatc
gagccggagcgggcgctgaaggacctcgtgtggttccgcgccggcggtccggccgaggtg
ctctaccagccggccgacgaggatgacctccgcgccttcctgccgaaggtgccggccgac
gtgccggtgaccgtgatcggcctcggctccaacctcatcgtccgcgacggcggcgtgccg
ggcgtggtgatccggctgtcggtgcgcggcttcggcggggtcgagcggctgggcgcgacg
cggctgaaggtcggtgccggcgtgccggacaagcatctcgcggcgaccgcgctcgacgcc
gggctctccggtttcgccttctaccacggcatccccggtggcatcggcggcgcgctcagg
atgaacgccggtgcccacggtgccgagacgcgcgagcgggtcgtcgaggtccgcgcggtg
acgcgtgccggcgaggcggtgacgctctccaacgaaggcatgggctattcctaccgccat
tcggacgcgccggcggagctgatcttcaccgctgccgtctacgagggcgtgccggccgag
cgcgacgcgatccgcgccgagatggacgcggtgcaggagcaccgcgagaagtcgcagccg
atccgctcgcgtaccggcggctccaccttcaagaacccgccggggcattcggcctggaag
ctggtcgacgccgccggctgccggggcctccgcatcggcgacgccgaggtctcgcagatg
cactgcaacttcctcatcaacaccgacgcggcgagtgcgcacgatatcgagctgctcggc
gagaccgtcagggcgcgggtgctggagacgagcggcgtgcggttggaatgggagatcaag
cggctgggcgtgttcgagccggggcgggcggtggagccgttcctggggcggtag

DBGET integrated database retrieval system