KEGG   Pleomorphomonas sp. SM30: OHA_1_04142Help
Entry
OHA_1_04142       CDS       T05766                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00473  D-Alanine metabolism
pleo00550  Peptidoglycan biosynthesis
pleo01100  Metabolic pathways
pleo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    OHA_1_04142 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OHA_1_04142 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OHA_1_04142 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_1_04142 (ddlB)
Enzymes [BR:pleo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     OHA_1_04142 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Amino acid ligase
   OHA_1_04142 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_YheCD ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BBE74511
UniProt: A0A2Z6I6J4
LinkDB All DBs
Position
1:4525885..4526808
Genome map
AA seq 307 aa AA seqDB search
MTKHVAVLMGGWSSERPVSLNSGKACADALEERGYRVTRIDVDRGIGTLLDELRPDVCFN
ALHGPYGEDGTIQGILEILDIPYTHSGVLASALAMNKPKAKHVLKAAGIPVVEHALVNRF
DAVKAHVLKPPYVVKPPAEGSSFGVLIVPADSPAPPQQLGTDAWPYGDNVMVERYIPGRE
LTCGVMGDDALGIIEVVPTGEGFYDYDAKYRPGGSRHILPAPLSPFIYQNVQRLALEAHR
ALGCRGVSRADFRFDDRGDGTGEVYCLEVNTQPGMTATSLVPEMAAHAGIEFGALVSWIV
EDASCKR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcacgtcgccgtcctgatgggaggctggtcgtccgagcgaccggtcagcctc
aactcgggcaaggcctgcgccgacgcgctcgaggagcgcggctaccgcgtcacccgcatc
gacgtcgaccgcgggatcgggacgctgctcgacgaactccgacccgacgtctgcttcaac
gccctgcacggcccctacggcgaggacggaaccatccaggggatcctggaaatcctggac
attccgtatacgcactcgggcgtcctcgcctctgcgctggccatgaacaagcccaaggcg
aaacacgtgttgaaggccgcgggaattcctgtggtcgagcacgcgctcgttaaccgtttc
gatgcggtgaaagcgcatgtcctgaagccaccctacgttgtcaagccgccggcggagggc
tccagcttcggcgtgctgatcgtgccggccgactcgcccgcgccgccgcagcagctcggc
accgacgcctggccctacggcgacaacgtcatggtggaacgctacattcccggccgcgag
ctgacctgcggcgtgatgggcgacgacgccctcgggatcatcgaggtggtgccgaccggc
gagggcttctacgactacgacgcgaaataccggccgggcggatcccggcacatcctgccg
gccccgctttcaccctttatttaccaaaatgtccaaagactggccttagaggcgcatcgg
gccctcgggtgtcgcggagtgagccgggccgacttccggttcgacgaccgcggcgacggg
accggcgaggtctactgcctggaagtcaacacccagccgggcatgaccgcgacgtcgctg
gttccggagatggcggcgcacgccggcatcgagttcggggccctggtgagttggatcgtg
gaggacgcgagttgcaagcgctga

DBGET integrated database retrieval system