KEGG   Pleomorphomonas sp. SM30: OHA_1_04233Help
Entry
OHA_1_04233       CDS       T05766                                 

Definition
(GenBank) D-xylulose reductase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00040  Pentose and glucuronate interconversions
pleo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OHA_1_04233
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     OHA_1_04233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BBE74598
UniProt: A0A2Z6I7C9
LinkDB All DBs
Position
1:complement(4617594..4618631)
Genome map
AA seq 345 aa AA seqDB search
MKALVLEEKGRLSLRDFPLEETVGPRDVRVAIKVVGVCGSDVHYYTHGAIGPFVVRAPMI
LGHEAAGVVTEVGAAVTELKVGDRVCMEPGIPDPTSRASRLGLYNLDPAVRFWATPPVHG
VLRPSVVHPADWCFKLPDQVSFAAGAMVEPLAVGVHAAGKARVKPGDVAVVIGAGPIGLL
TLLAARAAGCARVIVSDVDDDKLALAARLGAARTVDVRREPLAAAVAAETDGWGADVVFE
CSGAERAAAGVFDPLAPGGCVVFVGMPLAPVPYEVARAQVKEARVEHVFRYAHVFRRCVE
MLASGAIDVAPLITRTFPFSEAVAAFDYAAAAPKGEVKIQIEMEG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactggttctggaagagaagggccgcctgtcgctgcgcgacttccccctggag
gagacggtcggcccgcgcgacgtccgcgtcgcgatcaaagtggtcggcgtctgcggcagc
gacgtccactactacacccacggcgccatcggccccttcgtggtgcgcgcgccgatgatc
ctcggccacgaggccgctggcgtcgtcaccgaggtcggcgccgcggtgaccgagctgaag
gtcggcgaccgcgtctgcatggagccgggcatccccgacccgacctcgcgggcgagccgg
ctcggcctttacaacctcgaccccgccgtgcgcttctgggcgacgccgccggtccacggc
gtgctgcgcccctcggtcgtccaccccgccgactggtgcttcaagctgccggaccaggtc
tccttcgccgccggcgccatggtcgagccgctcgccgtcggcgtccacgccgccggcaag
gcgcgcgtcaagccgggcgacgtcgcggtggtgatcggcgccggcccgatcggcctcctg
accctcctcgccgcccgcgccgccggctgcgcccgcgtgatcgtctcagacgtcgacgac
gacaagctcgccctcgccgcccgcctcggcgccgcccgcaccgtcgacgtccgccgcgag
ccgctcgccgccgccgtcgccgccgagaccgacggctggggcgccgacgtggtgttcgag
tgctccggcgccgagcgcgccgccgccggcgtgttcgacccgctggcgcccggcggctgc
gtcgtcttcgtcggcatgccgctcgccccggtgccctacgaggtggcgcgcgcccaggtc
aaggaggcccgcgtcgagcacgtcttccgctacgcccacgtcttccgccgctgcgtcgag
atgctcgcctccggcgccatcgacgtcgcccccctgatcacccgcaccttccccttctcc
gaagccgtcgccgccttcgactacgccgcggcggccccgaagggcgaggtgaagatccag
atcgagatggaggggtaa

DBGET integrated database retrieval system