KEGG   Pleomorphomonas sp. SM30: OHA_2_00096
Entry
OHA_2_00096       CDS       T05766                                 

Gene name
alr
Definition
(GenBank) alanine racemase, biosynthetic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00473  D-Alanine metabolism
pleo01100  Metabolic pathways
pleo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    OHA_2_00096 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    OHA_2_00096 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
    OHA_2_00096 (alr)
Enzymes [BR:pleo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     OHA_2_00096 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pleo01011]
 Precursor biosynthesis
  Racemase
   OHA_2_00096 (alr)
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Other DBs
NCBI-ProteinID: BBE74894
LinkDB
Position
pSM30-1:115465..116601
AA seq 378 aa
MYADAWLVTQDSHTGAGRLTIDLGAVVANWRAVAARQPGAETGAVVKADAYGLGARRVAR
ALAAAGCRSFFVAQLGEAVELRRALPPEARLFVLNGLVPGAEALAVETGAVPVLNSLPQV
ARYAAEARRRDRRLPAALQVDSGMSRLGLSPAEVDTLAADPTMLDGVEVVLVMSHLACAD
EPANPANAAQHAAFVALADRLPAAPRALANSAGSAFAGFGHEVTRPGLALYGVEPTGRTD
AGLRPVVTLEAPVVQLRTVAAGTGVGYGLSHVTSAETRLATIGVGYADGWPRHLGGRGAV
WFDGVRLPIVGRVSMDSLTVDVSALPEGALAEGAMVELVGPHQSLQDVADAADTIAWEIL
TRLGARYERRYLEAGPAA
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtacgccgacgcctggctggtcacgcaggattcgcacacgggcgcgggccgcctgacg
atcgacctcggcgccgtcgtcgccaactggcgcgccgtcgccgcccgccagccgggtgcc
gagaccggcgccgtggtcaaggccgacgcctacggcctcggcgcccgccgcgtcgcccgc
gcgctcgccgccgccggctgccgaagcttcttcgtcgcccagctcggcgaggcggtcgag
ttgcgccgcgcgctgccgccggaggcccggctgttcgtgctgaacggtctcgtgcccggc
gccgaggcgctcgcggtcgagaccggcgcggtgccggtgctgaactcgctgccccaggtc
gcccgctacgccgccgaggcgcgccggcgcgaccggcgcctgccggccgcgctgcaggtc
gacagcggcatgtccaggctcggactgtcgccggccgaggtcgacaccctcgccgccgac
ccgaccatgctcgacggcgtcgaggtcgtgctggtgatgtcgcatctcgcctgcgccgac
gagccggccaatccggccaacgccgcccagcacgccgccttcgtcgccctcgccgaccgc
ctgccggcggcgccgcgcgccctcgccaactccgccggctcggccttcgccggcttcggc
cacgaggtgacccgccccggcctcgcgctctacggcgtcgagccgacggggcgcaccgac
gcgggcctgcgcccggtcgtgaccctcgaggcgccggtggtccagctgcggaccgtggcg
gccggcaccggcgtcggctacggcctttcccacgtcacctccgccgagacccggctcgcg
acgatcggcgtcggctacgccgacggctggccgcgccacctcggcggccgcggcgccgtc
tggttcgacggcgtccgactgccgatcgtcggccgcgtctcgatggacagcctcacggtc
gacgtctcggcgctgcccgagggtgcgctcgccgagggcgcgatggtcgagctggtcggc
ccgcaccagagcctgcaggacgtcgccgacgccgccgacaccatcgcctgggagatcctg
acccggctcggcgcgcgctacgagcgccgctacctcgaggccggccccgccgcctga

DBGET integrated database retrieval system