KEGG   Pantoea ananatis LMG 5342: PANA5342_0193Help
Entry
PANA5342_0193     CDS       T01728                                 

Gene name
argE1
Definition
(GenBank) acetylornithine deacetylase (ArgE)
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00220  Arginine biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
plf01210  2-Oxocarboxylic acid metabolism
plf01230  Biosynthesis of amino acids
Module
plf_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PANA5342_0193 (argE1)
Enzymes [BR:plf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     PANA5342_0193 (argE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: CCF07586
LinkDB All DBs
Position
complement(208644..209792)
Genome map
AA seq 382 aa AA seqDB search
MKTKLPPFIELYRQLIATPSISATDAALDQSNETLINLLAGWFRDLGFAVEVQPVPGTRH
KFNMLARTGNGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFI
LDTLRDVDVTTLSKPLYILATADEETTMAGAKYFAESTQLRPDCAIIGEPTSLKPVRAHK
GHISNAIRIQGQSGHSSDPGRGVNAIELMHESITELMQLRNTLKSRYHHDGFAIPYPTMN
FGHIHGGDAANRICACCELHMDIRPLPGLTLSDLDGLLNEALAPVSERWPGRITIEEMHP
PIPGYECPADHELVKVVETLLGIQTEVVNYCTEAPFIQQLCPTLVLGPGSINQAHQPDEF
IDTAFIKPTRALISQVVQHFCH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacaaaattaccgccttttatcgaactataccgccagttgatcgctacgccgtca
atcagcgcaaccgatgccgcactcgatcagagcaatgaaactttaatcaatttactggct
ggctggttccgcgacctgggttttgctgtggaagtacagcccgtacccggaacacgtcat
aaatttaatatgctggcgcgcaccggaaacggcgcgggcggcctgctgcttgccgggcat
accgataccgttccgttcgatgatggtcgctggactcgcgatccctttaccctgaccgaa
catgacaacaagctgtacggtctgggcaccgccgatatgaaaggcttctttgcgtttatt
ctggacacgctacgtgatgtggatgtgacaaccctgagtaagccgctgtacattttggcg
accgccgatgaagaaaccacgatggcaggtgcgaaatattttgcagagtccacccagctt
cgccccgactgcgccattattggcgaaccgacctcgctaaagccggtgcgggcgcacaaa
ggccatatatctaatgcgattcgcattcagggacaatcgggccactccagcgatcccgga
cgcggcgtcaatgccattgagctaatgcatgagtcgattaccgaactcatgcagttgcgt
aacacactcaaatcacgttaccaccacgatggctttgccatcccctatccgaccatgaac
tttggtcatattcacggcggcgatgcggcaaaccgtatctgtgcctgctgcgaattgcat
atggatatccggcccctgccgggccttacgctgagcgatctcgacgggctgctaaatgaa
gcactggcaccggtaagcgaacgctggccgggacggatcaccattgaagaaatgcatcca
ccgattcccggctacgagtgccccgctgatcatgaactggttaaagtggtagaaacgctg
ctggggattcagacggaagtggtgaattactgcactgaagcgccttttattcagcaactc
tgcccaaccctggtactgggcccaggatcgatcaatcaggcgcaccagccagacgagttt
atcgataccgcatttattaagcctacccgtgcgctgataagccaggttgtgcagcatttc
tgtcactaa

DBGET integrated database retrieval system