KEGG   Pantoea ananatis LMG 5342: PANA5342_0212Help
Entry
PANA5342_0212     CDS       T01728                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00290  Valine, leucine and isoleucine biosynthesis
plf00770  Pantothenate and CoA biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
plf01210  2-Oxocarboxylic acid metabolism
plf01230  Biosynthesis of amino acids
Module
plf_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
plf_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PANA5342_0212 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PANA5342_0212 (ilvD)
Enzymes [BR:plf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     PANA5342_0212 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: CCF07605
LinkDB All DBs
Position
235062..236912
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGANPNVSDAD
SEQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKELFINAGKRIV
SLTKRYYEQDDANMLPRNIATKAAFENAMTLDIAMGGSTNTVLHLLAAAQEGEIDFNISD
IDRLSRKVPQLCKVAPSTPKYHMEDVHRAGGVIGILGELDRAGLIDTSARNILQQSMRET
IDQYDIMLTQDQAVKDMFRAGPAGIRTTQAFSQNCRWDTLDDDRTEGCIRTRENAYSQDG
GLAVLYGNIAEDGCIVKTAGVDKEILTFSGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTTYLKSMGLGKSCALITDGRFSGGTSGLSIGHASPEAANGGTIAL
VKDGDTIEIDIPNRGIKLAVPDNELHARREEQEARGDAAYTPMNRQREVSFALRAYASLA
TSADKGAVRDKSKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtaccgttccgctaccaccacccacggccgcaacatggccggtgcccgtgcc
ctctggcgcgcaacaggaatgaccgacgatgatttcggcaaaccgattatcgccgtcgtg
aactccttcacccagtttgtgccgggccacgttcacctgcgtgatctgggtaagctggtt
gccgagcaaatcgaagcggctggtggcgtggccaaagagttcaacacgatagcggtggat
gacggtattgccatgggccatggcggcatgctgtattctctgccttcccgggaactgatt
gctgactccgtcgagtacatggtgaatgcgcactgtgccgatgccatggtctgcatctct
aactgcgacaaaatcacccccggcatgttgatggcgtcactgcgccttaacattccggtt
atctttgtgtccggcggcccgatggaagccggtaaaaccaagctctccgatcagatcatc
aagctggatctggtggatgccatgatccagggcgctaacccgaacgtcagcgatgccgac
agcgagcagattgaacgctccgcctgtccgacctgcggctcctgttcaggcatgttcact
gcaaactccatgaactgcctgaccgaagcgctgggcctgtcgcaaccgggtaacggttcc
ctgctggccactcacgccgaccgtaaagaactgtttatcaacgccggtaagcgcatcgtg
agcctgaccaaacgctattacgagcaggacgatgccaacatgctgccgcgtaacattgcc
actaaggctgcgtttgaaaatgccatgacgctggatatcgccatgggcggctccaccaac
accgtgctgcacttgctggctgccgcgcaggaaggcgagatcgacttcaatatttctgat
atcgatcgcctgtcgcgcaaagtgcctcagctgtgcaaagtcgcacccagtaccccgaaa
tatcacatggaagatgtgcaccgcgccggtggcgtgatcggtattctcggcgagttggat
cgtgccggactgattgacaccagcgcacgcaacatcctgcagcaaagcatgcgtgaaacg
atcgatcagtacgacatcatgctgacccaggaccaggccgtgaaggacatgttccgcgcg
ggcccggccggtatccgcaccacccaggcgttctcacagaattgccgttgggatacgctg
gatgatgaccgtactgaaggctgtatccgtacgcgcgaaaacgcctattctcaggatggc
ggtctggccgtgctgtacggcaacatcgccgaagatggctgtatcgtgaaaacggcgggc
gtcgataaagagattctgaccttcagcggcccggccaaagtgtatgaaagccaggatgac
gcagtagaagccatcctcggtggcaaagtggtggcaggtgacgtggttgtgattcgctac
gaagggccaaaaggcggaccgggcatgcaggaaatgctgtatcccaccacctacctgaaa
tcgatggggctgggtaagagctgtgccctgatcaccgacggtcgcttctctggcggtacc
tctggcctctccattggtcatgcctcacccgaggcagctaatggcggcaccatcgcgctg
gttaaagatggcgataccattgaaattgatattcctaaccgcggcatcaagctggccgtg
ccggataatgaactgcacgcgcgccgtgaagagcaggaagcacgtggcgatgccgcttac
acgccgatgaaccgtcagcgcgaagtgtcgtttgccctgcgcgcctatgcatcgcttgcc
accagtgccgacaaaggtgccgtgcgcgataagagtaagctgggaggctaa

DBGET integrated database retrieval system