KEGG   Pantoea ananatis LMG 5342: PANA5342_0239Help
Entry
PANA5342_0239     CDS       T01728                                 

Gene name
yjjN
Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00053  Ascorbate and aldarate metabolism
plf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    PANA5342_0239 (yjjN)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     PANA5342_0239 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Pyr_redox_3 FAD_oxidored HI0933_like FAD_binding_3 FAD_binding_2 UDPG_MGDP_dh_N Sacchrp_dh_NADP adh_short Pyr_redox NAD_binding_7 GIDA NAD_binding_8 Thi4 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CCF07632
LinkDB All DBs
Position
266129..267157
Genome map
AA seq 342 aa AA seqDB search
MTTMKALVIAEPRNMVWTTRATPQPAPGEVLIKIVSAGICGTDIHAWAGNQPFFSYPRVL
GHELCADIVETGSAVEGFAVGQRVALIPYLSCYQCDACQSGKTNCCEHISVIGVHQDGGF
CDYLSVPASNLLAVDALAPEAAALIEPFAISAHAVRRAAVAQGDAVLVVGAGPIGLGAAA
IAAANGAQVIVADTSEYRRQHVSQQLGLPALNPADADFIAKLRAGFNGQLALTLIDATGN
PAAMNAAVNLIRHGGTVVYVGLHKGDLVIPDSEFHKKESTLMGSRNATREDFDRVHELMA
AGKLRADMMLNRRFAFSTLAEHFEEAVINNRELIKGVIDFDR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatgaaagcattagtcatcgccgaaccacgcaatatggtctggaccacgcgc
gcaacgcctcaacccgcgccaggggaggtgctgattaaaattgtcagcgcgggcatctgc
ggcacggatatccatgcctgggcgggaaaccaacctttttttagctatccacgggtactc
gggcatgaactctgcgcagacattgttgaaacaggcagcgccgtggaggggtttgccgtt
ggccagcgcgtggcgctgatcccctatctctcctgttatcagtgcgatgcctgccaaagc
ggtaaaaccaactgttgtgaacatatctcagttattggcgtacatcaggatggcggcttt
tgtgactatctgagcgtgcctgcgtcaaacctgttggccgtggacgcgctggcacctgag
gcggcggcgctgattgaaccctttgcgattagcgcccatgcggtaaggcgtgcggcagtg
gcacagggcgatgccgtgctggtggtgggcgctggccctattgggctgggggcggcggcc
atcgcggcggccaatggcgcgcaggtcatcgtggcggacaccagtgaataccgccgccag
cacgtcagtcaacagctgggtcttcccgcgcttaacccggctgacgccgatttcatcgcc
aagctgcgcgctggatttaacggtcagctggcgttaaccctgatcgatgccacgggcaac
ccggcggccatgaacgcggcggtaaacctgattcggcatggcggtacggtggtttatgta
ggcctgcacaaaggcgatctggtcatccctgacagtgaatttcacaaaaaagagagtacg
ttgatgggcagccggaacgctacgcgcgaagattttgaccgggtgcatgaactcatggcc
gccgggaaactgcgagcagacatgatgctgaaccgccgtttcgccttctctacgctggca
gagcattttgaggaagcggttatcaacaatcgtgagttgattaaaggcgttatcgatttt
gatcgctaa

DBGET integrated database retrieval system