KEGG   Pantoea ananatis LMG 5342: PANA5342_0376Help
Entry
PANA5342_0376     CDS       T01728                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01130  Biosynthesis of antibiotics
plf01230  Biosynthesis of amino acids
Module
plf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA5342_0376 (aroK)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PANA5342_0376 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE ABC_tran APS_kinase AAA_5 AAA_7 AAA_25 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_PrkA AAA_28 AAA_29 His_biosynth RsgA_GTPase Mg_chelatase AAA_14 IstB_IS21 AAA_2
Motif
Other DBs
NCBI-ProteinID: CCF07769
LinkDB All DBs
Position
416216..416737
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEAGFR
DREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVESPPREVLEALAGERNPLYEEIADVTIRTDDQSAKVVANQIIHMLEKS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggccgatgggtgccggcaaaagcactatt
ggccgtcagttggctcagcaactcaatatggagttcttcgattccgatcaggaaattgag
cgacgcaccggagcggatgtgggctgggtttttgacgttgaaggcgaagctggcttccgc
gatcgtgaagaaaaaatcatcaatgaactgaccgagaagcagggcatcgtcctggcgacc
ggcggtggctccgtaaaatcccgggaaacacgtaatcgtctctccgctcgcggcgtcgtg
gtgtatcttgaaaccactattgagaaacaactggcacgtacacagcgtgataaaaaacgc
cccttactgcaggtagaatcaccgccgcgtgaagtgcttgaagcgctggcaggtgaacgt
aacccgctttatgaagagatcgccgacgtcactatccgcactgacgatcaaagtgcaaaa
gtggtggcgaatcagattatccacatgttggaaaaaagttga

DBGET integrated database retrieval system