KEGG   Pantoea ananatis LMG 5342: PANA5342_1408Help
Entry
PANA5342_1408     CDS       T01728                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00250  Alanine, aspartate and glutamate metabolism
plf00410  beta-Alanine metabolism
plf00640  Propanoate metabolism
plf00650  Butanoate metabolism
plf01100  Metabolic pathways
plf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PANA5342_1408 (goaG)
   00650 Butanoate metabolism
    PANA5342_1408 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PANA5342_1408 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA5342_1408 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plf01007]
    PANA5342_1408 (goaG)
Enzymes [BR:plf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PANA5342_1408 (goaG)
Amino acid related enzymes [BR:plf01007]
 Aminotransferase (transaminase)
  Class III
   PANA5342_1408 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCF08801
LinkDB All DBs
Position
complement(1457001..1458263)
Genome map
AA seq 420 aa AA seqDB search
MSNSEVQVRRLNATPRGVGVMCDFYAVKAENATLWDHQGREIIDFSAGIAVLNTGHRHPK
VIAAIKEQLDHFTHTAFQVVPYENYIALAEKLNALVPVSGPAKTTFFSTGAEAVENAVKI
ARAATGRPGVIAFTGAFHGRTNMTMSLTGKVVPYKTGFGPFASSVFHARYPNALHGCSVD
DALESLQTIFRCDISPQQVAAIIYEPIQGEGGFNVAPPAFVTALRTLCDQHGILLIADEI
QSGFARTGKLFASEYYPDVQPDLITMAKSLAGGMPLSAVSGRADVMDAPLPGGLGGTYAG
SPPAIAAALAVLEVIRDENLCEHALLLGGQLTETLQGAGCSALAEVRGRGSMIAAEFTNS
EGQPSAEIAKAIQQEALDEGLLLLTCGVHGNVIRFLYPLTIPDAQFRTALNLLNRILGKY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacagtgaagtgcaggtccgtcgtctcaatgctacgccgcgcggcgtgggcgtg
atgtgcgatttctatgcggtgaaagcagaaaacgctacgttatgggatcaccagggccgt
gaaattatcgatttcagcgcaggcattgccgtgctgaataccggacatcgtcatcccaaa
gtgatcgccgccatcaaagaacagctcgatcattttacccacaccgcgtttcaggttgtg
ccttacgaaaattatattgccttggcggaaaaactgaatgcgctggtgccggtaagcggc
cccgccaagaccacttttttctccaccggcgcagaagccgttgagaacgcggtcaaaatt
gcccgcgcggcaaccggccgtcccggcgtcatcgcctttacgggggcctttcacggccgc
accaacatgacgatgtcgctgacgggcaaagtggtcccctacaaaaccggtttcggcccc
tttgccagctcagtatttcacgcccgctacccgaatgcactgcatggctgtagcgtcgat
gacgcgctggagagtttacaaaccattttccgctgcgatatcagcccgcaacaggttgcg
gccattatctatgaacccattcaaggtgaaggcggcttcaatgtcgcgccgccagcgttt
gtgaccgccctgcgcacgctgtgcgatcaacatggcattctgctgatcgccgatgaaatc
caaagtggttttgcccgcaccggcaagctgtttgccagtgaatactatcctgacgtgcag
ccagacctgatcaccatggcaaaaagcctggcgggcggtatgccgctatcggcggtttca
gggcgggctgacgtaatggatgcgcccctgcccggcggcctgggtggcacctatgcagga
agcccaccggccattgccgctgcgctggccgtgctggaggtcattcgcgatgaaaacctg
tgcgagcacgccctgctgttaggcgggcaactgacggaaacgctgcagggcgcaggctgt
agtgcgctggcagaggtgcgcggtcgcggttctatgatcgcggctgaattcaccaacagc
gaaggccaacccagcgcagagatcgccaaagctattcagcaagaggcgctggacgaaggg
ttgctgctgctcacctgcggcgtacacggcaacgttattcgtttcctctaccctctcacc
attccggacgcgcagttccgcacagcactgaatctgctgaaccgtatcctgggcaagtat
tag

DBGET integrated database retrieval system