KEGG   Pantoea ananatis LMG 5342: PANA5342_1551Help
Entry
PANA5342_1551     CDS       T01728                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plf  Pantoea ananatis LMG 5342
Brite
KEGG Orthology (KO) [BR:plf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PANA5342_1551 (ahpF)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PANA5342_1551 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 NAD_binding_8 Thi4 DAO Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: CCF08944
LinkDB All DBs
Position
1632199..1633767
Genome map
AA seq 522 aa AA seqDB search
MLDTNLKTQLKAYLEKLTKPVELIATLDDGAKSTEIRNLLVDIASLSDKVSFREENDRQV
RKPSFLITNPGADQGPRFAGSPLGHEFTSLVLALLQTGGHPSKEAQSLLDQIAALDGDFH
FETYYSLSCHNCPDVVQALNLMAVLNPRISHTAIDGGLFQNEIQERNVMGVPAVYLNGKE
FGQGRMSLAEIVSKVDTNADKRAAEELNKREAYEVLIVGSGPAGAAAAIYSARKGIRTAL
LGERFGGQVLDTVDIENYISVQKTEGAKLAGALRAHVDDYNVDIIDSQSAIKLIPSAVKG
GLHAIETASGAVLKSRSIILATGARWRNMGVPGEEQYRTKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVEHVTLLEFASEMRADKVLQDKLRSLKNVDVILNAQTTEVKGD
GSKVTGLQFLDRTNQTTHELALSGIFVQIGLLPNTNWLEGAVERNKMGEIMIDAKCETSL
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTQPAH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataccaatttaaaaacacagctcaaagcctatcttgagaaactcaccaagcct
gtggagttgattgcgacgctggatgatggcgcgaaatcaacggagattcgcaatttgttg
gtcgatatcgcgagcctgtctgacaaggtcagctttcgtgaagagaacgatcgtcaggtg
cgtaagccctcgtttttaatcactaatccaggcgctgatcaggggccgcgttttgccggt
tcgccgctgggtcatgaatttacctcactggtactggcactgctacagaccggtgggcat
ccctctaaagaagcgcaaagcctgctcgaccagattgcggcgctggatggggatttccat
ttcgaaacctattattcactgtcgtgccacaactgtccggatgtggtgcaggcattaaac
ctgatggcggtgttaaacccacgtatcagtcacaccgccattgacggtggcctgttccag
aatgaaattcaggaacgcaatgtgatgggcgtgcccgctgtctatctgaatggcaaagaa
ttcggtcagggccgcatgagcctggcggagattgtcagcaaagtcgacaccaatgcagat
aagcgtgccgcagaagagctgaacaagcgtgaggcttacgaggttctgatcgtgggcagc
ggtccggcgggcgccgccgcggctatctactccgcacgtaaagggattcgcaccgcgtta
ctgggcgagcgctttggtggacaggtgttggatacagtcgatattgaaaactacatttcc
gtacagaaaacggaaggggccaaactggccggtgccctgcgcgctcacgtggatgattac
aacgttgacatcattgacagccagagcgcgattaaactgattccctcagcggtgaaaggc
ggcctgcacgctattgaaacggcctccggcgcggtgctgaaatcgcgcagtatcattctt
gccaccggtgcgcgctggcgcaacatgggcgtgcctggcgaagagcaatatcgcaccaaa
ggcgtgacgtactgcccacactgcgacggcccgctgtttaaaggcaaacgcacggcggtc
attggcggcggtaactccggcgtagaagccgcaatcgatctggcgggcattgttgaacac
gtgacgctgctggagttcgccagtgaaatgcgtgcagataaagtgctgcaggacaaactg
cgcagcctgaaaaacgtggatgtgattctgaatgcacaaaccacggaagtgaaaggcgat
ggcagtaaggtgacgggcctgcaatttctggatcgcactaaccagactactcatgagctg
gcgctgtcgggcattttcgtgcagatcggtctgctgcctaacaccaactggctggaaggc
gcggttgagcgcaacaagatgggcgaaatcatgatcgatgcgaaatgcgaaaccagcctg
aaaggcgttttcgccgcaggggactgcaccaccgttccttataagcagatcatcatcgcc
agcggtgaaggagcaaaagcctcactgagcgcgtttgattacctgattcgcacccagcct
gcgcactaa

DBGET integrated database retrieval system