KEGG   Pantoea ananatis LMG 5342: PANA5342_2080Help
Entry
PANA5342_2080     CDS       T01728                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00240  Pyrimidine metabolism
plf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PANA5342_2080 (tdk)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PANA5342_2080 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: CCF09473
LinkDB All DBs
Position
2182886..2183557
Genome map
AA seq 223 aa AA seqDB search
MVKSALFFHRIRESAQMAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVYTAEIDNRF
GAGKVSSRIGLSSPAVLYNAASQLDVEIAQEHARQPVHCVLVDESQFLTREQVKALSDVV
DNLDIPVLCYGLRTDFLGELFTGSQYLLAWADKLVELKTVCHCGRKAGMVLRLDSDGKPF
REGEQVVIGGNERYISVCRKHYKKAIEQGCLQAIHGAQTPVGE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatcggccctgttttttcatcgtatccgagaatcggcgcaaatggctcaactc
tatttctactattcggcaatgaacgccggtaaatcaaccgcattattgcagtcatcctac
aattatcaggaacgcgggatgcgcacgctcgtctataccgctgagatcgacaatcgcttc
ggcgcaggcaaggtgagctcgcgtattggattatcttctcctgcggtgctttataatgca
gccagccagcttgatgtggaaattgcccaggaacatgcgcgacaacccgttcactgtgta
ctggtggacgaaagccagtttctgacgcgtgagcaggttaaggccttgtctgacgtggta
gataatctggatattcccgtactctgctacgggctgcgtaccgattttcttggtgaactc
ttcaccggtagccagtatcttctggcatgggcggataagctggtagagctgaaaacggtc
tgtcattgtggacgtaaagcgggcatggtgctgcgtctggacagtgacggtaaacctttc
agagagggggagcaggtcgtcatcggcggcaacgaacgttatatctccgtatgccgtaag
cattataaaaaggcgatagagcagggttgtttgcaggccatccatggggcgcaaaccccc
gtgggggaataa

DBGET integrated database retrieval system