KEGG   Pantoea ananatis LMG 5342: PANA5342_2323Help
Entry
PANA5342_2323     CDS       T01728                                 

Definition
(GenBank) xylose isomerase domain protein TIM barrel
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00040  Pentose and glucuronate interconversions
plf00051  Fructose and mannose metabolism
plf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA5342_2323
   00051 Fructose and mannose metabolism
    PANA5342_2323
Enzymes [BR:plf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PANA5342_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CCF09716
LinkDB All DBs
Position
complement(2430781..2431761)
Genome map
AA seq 326 aa AA seqDB search
MSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSDSKT
LRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSRLMT
LWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNVTTC
LLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGLMAA
SVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQLNAN
PALAEAISRQDAVASQQIVNDIMLAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggcacatctctac
tggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcaggcaaggtt
aaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgacagtaaaacg
ctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatgcggtgggat
gcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgccgtgaggcg
attgacctgaccaagcggggaatcgataccggacgggaatttggctcccgcttaatgacg
ttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaaaaaatctgg
gaagacgccgtcagcgcggtacgtgaaatcgccgactacgcgccggacgtggatgtgagc
attgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtgaccacctgc
ctgctggccgtcgaagaggccggaagcccgaatctcggcatcacgctggatttcgcccat
gtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgtcgttcccgg
ctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactgatggcggca
tcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgatggttatcag
ggcgcctactattttgacaccttcccggatgccagcggactggatccagtacgtgaagcc
gaaaccaacattgccaccgtgacgcgattactcaagctttgcgaccagcttaatgctaat
ccggcgctggcagaggcgatcagccgtcaggatgcggtcgcctcacagcaaatcgtcaac
gacattatgctggcgcgttaa

DBGET integrated database retrieval system