KEGG   Paucimonas lemoignei: NCTC10937_01079Help
Entry
NCTC10937_01079   CDS       T05492                                 

Gene name
ddl_1
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
plg  Paucimonas lemoignei
Pathway
plg00473  D-Alanine metabolism
plg00550  Peptidoglycan biosynthesis
plg01100  Metabolic pathways
plg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC10937_01079 (ddl_1)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC10937_01079 (ddl_1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCTC10937_01079 (ddl_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plg01011]
    NCTC10937_01079 (ddl_1)
Enzymes [BR:plg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCTC10937_01079 (ddl_1)
Peptidoglycan biosynthesis and degradation proteins [BR:plg01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC10937_01079 (ddl_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 TTL ATPgrasp_YheCD FOG_N
Motif
Other DBs
NCBI-ProteinID: SQF95738
UniProt: A0A2X4A8U9
LinkDB All DBs
Position
1:1200313..1201272
Genome map
AA seq 319 aa AA seqDB search
MTAILQSLLRSTVEPKDFGRVAVLFGGKSAERPVSLKSGQAVLEALQSAGVDAFGIDVGD
DFLQRLVSEKIDRAFIVLHGRGGEDGTMQGLLECLEIPYTGSGVLASALAMDKLRTKQVW
QSLGLPTPLHAVLGNESDCISAVAELGLPLIVKPAHEGSSIGMAKVTSVEELIVAWRTAS
TYDSQVLVEQWIQGPEFTIASLRGQVLPPIGLGTPHSFYDYDAKYLADDTQYRIPCGLDD
PKEHELKQLTMRACEAVGVSGWARTDVMQDAHGKFWLLEVNTVPGMTDHSLVPMAARAAG
LDFQQLVLAILADSVQGRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgatcctgcaatcgttgctgcgctccacggtagagccgaaagacttcggccgc
gttgccgtgctgtttggcggcaagagtgccgagcgcccggtttccttgaaatcagggcag
gccgtgctggaagctttgcagagcgctggcgtcgatgcttttggcatcgatgtgggcgac
gacttcctgcagcgtctggtcagcgaaaagattgatcgcgcgttcattgtgctgcacggc
cgcggtggcgaagacggcaccatgcagggcttgctggagtgtctggaaatcccttacacc
ggcagcggcgtactggcttcggcactggcgatggacaagttgcgtaccaagcaagtctgg
cagagtctgggcctgccaacgcctttgcacgcggtgcttggcaacgaatccgactgtatt
tctgcagttgcggaactgggcctgcctttgatcgtcaaaccggctcatgaaggttccagt
atcggtatggccaaggtgaccagcgtcgaagaattgatcgtcgcttggagaaccgccagt
acctacgattcgcaagtgttggtagagcagtggattcaaggtcccgagttcaccatcgct
tcgctgcgtggccaggttttgcctcccatcggcctgggcactcctcacagtttttacgac
tacgacgccaagtacctggctgacgatacccagtatcggattccgtgcggcctcgatgac
cccaaggaacatgaactcaagcaactgaccatgcgcgcctgcgaagccgttggcgtatcc
ggctgggcgcgtactgatgtcatgcaggatgcccacggcaagttctggctgctggaagtg
aacacggtgccgggcatgaccgaccacagtctggtgccgatggcggcccgtgcggcaggt
ctggatttccagcaactggtgttggcgattctggctgacagcgttcaggggcgaggctaa

DBGET integrated database retrieval system