KEGG   Paucimonas lemoignei: NCTC10937_01443Help
Entry
NCTC10937_01443   CDS       T05492                                 

Definition
(GenBank) Uncharacterised protein
Organism
plg  Paucimonas lemoignei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_pp85
Motif
Other DBs
NCBI-ProteinID: SQF97339
UniProt: A0A2X4AHI5
LinkDB All DBs
Position
1:1606477..1606788
Genome map
AA seq 103 aa AA seqDB search
MRIDGPSQRSYPIKRKPGKAPAIVEGTFEEVEADAEVVPRSAQNARSSGAGQSASTANVP
ARPQDIIFPRSMSTRVAHALASYLSTASFVDWDLEIAELDVHV
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatagacggcccttcacaacgttcctacccgatcaaacgcaagcctggcaaggct
cctgcgattgtggaaggtacctttgaggaagtggaagctgacgcagaagtggtcccacgg
tctgctcagaatgcgcgctccagtggcgcaggtcagtccgcatcgactgcaaacgtccca
gcccgcccgcaagacatcatattccctcgctcgatgagcactcgcgttgcccacgcattg
gccagttacctgtccaccgccagtttcgttgactgggatctggaaattgcagagctcgac
gtccacgtttga

DBGET integrated database retrieval system