KEGG   Paucimonas lemoignei: NCTC10937_01823Help
Entry
NCTC10937_01823   CDS       T05492                                 

Gene name
yfcG_1
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plg  Paucimonas lemoignei
Pathway
plg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC10937_01823 (yfcG_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plg02000]
    NCTC10937_01823 (yfcG_1)
Enzymes [BR:plg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NCTC10937_01823 (yfcG_1)
Transporters [BR:plg02000]
 Other Transporters
  Pores ion channels [TC:1]
   NCTC10937_01823 (yfcG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-ProteinID: SQF97704
UniProt: A0A2X4A4Q4
LinkDB All DBs
Position
1:2034327..2034929
Genome map
AA seq 200 aa AA seqDB search
MYKVYGDYNSGNCYKIKLMLNLLGAQYHWIPVDILKGETQSAAFLEKNPNGKIPVLELED
GTCLWESNAILNFLADSTHYLPSEPRLRTQVLQWQFFEQYSHEPSIAVARFIQFYLGLPE
ERLEEYRSLQKAGHRALAVMEQQLKRTPFLVGDAFSIADIALYAYTHVAHQGGFDLTAYP
GIEQWLERVKQQPGYIGMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttacggcgattacaactcgggcaactgctacaagatcaagctcatgctc
aacctgttgggcgcgcaatatcactggataccggtggatattctcaagggtgagacccag
agcgcggcctttctggagaaaaaccccaacggcaagattccggtgcttgagcttgaagat
ggcacctgcctgtgggaatccaatgccattctcaactttctcgccgacagcacccattac
ctgccgagtgagccgcgcttgaggacgcaggtgctgcaatggcaattcttcgagcagtac
agccacgagccgagcatcgccgtcgcccgtttcattcagttttatctgggcttgcctgaa
gagcgtcttgaagaataccgctcgctgcagaaggcaggtcatcgcgccttggccgtgatg
gaacagcaactcaaacgcacgccttttctggtgggcgatgcgttctcgatcgccgatatc
gcgttgtacgcctacacccacgttgcccatcaaggtggcttcgatctgacggcgtatccg
ggcattgagcaatggttggagcgggtcaaacagcagcctggttacattggcatgctggat
tga

DBGET integrated database retrieval system