KEGG   Paucimonas lemoignei: NCTC10937_02207Help
Entry
NCTC10937_02207   CDS       T05492                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plg  Paucimonas lemoignei
Pathway
plg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:plg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NCTC10937_02207 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plg03400]
    NCTC10937_02207 (ligD)
Enzymes [BR:plg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NCTC10937_02207 (ligD)
DNA repair and recombination proteins [BR:plg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NCTC10937_02207 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: SQF98084
UniProt: A0A2X4A5Q6
LinkDB All DBs
Position
1:complement(2463567..2466320)
Genome map
AA seq 917 aa AA seqDB search
MSAALDEYNRKRDFDATSEPSGNEAKGRRGASKTKTSTKAAHALQFCIQKHDASRLHYDF
RLELDGTLKSWAVPKGPSLDPKAKRLAVHVEDHPISYATFEGSIPEGHYGAGDVIVWDRG
VWKPLSDPAEAYTKGRLKFELQGEKLAGVWNLVRTHMPGKQEQWFLIKHQDEFARPESDY
DVVKAEPHSVLSERTIVEKQAAKKSPKKSSAKTAEPKPASPKPVEKVGKAAAAESATASK
KSSGKTLLANAEPAAIPDSIKPELATLVDSAPEGDWRYEIKFDGYRVMARINDGKVQLFT
RNGHDWTHKLPRQAEALASLDLESAWLDGEMVVANEQGVPDFQSLQNAFEAGSSDAISYY
LFDMPYLNGMDLRQVPVEQRRAALAKVLERSEDPVLRFSEDFAETPDALLNTACQMKMEG
LIGKRTGSAYVSRRSGDWIKLKCKRRQEFVVVGFTEPKGARSKFGALLLGLHDADSGELR
YAGKVGTGFNEATLSSIHQQLTPLEVKKPAVINPPTGFEAKGVHWLKPQLLAEVAFAEIT
QDGSVRHAVFHGLRTDKPARSITEERPATPARQKKTASKTAAHSAKAKTTAAEAEAQPKP
EPKPKPKSNAKPKAEETKTTEPALTGKVRLTHPERIIDPVSGATKRDLADYYIRISEWLL
PQLKNRPVALVRAPEGITGELFFQKNADRLSIPGIETMGKEYTGHPMMLINNLEALIGAV
QMSTIELHTWNAVSKDLERPDRFILDLDPDPALPWKSMVEATQLTLTVLDELGLKSFLKT
SGGKGIHIVVPLTPKADWDAVKDFSHAIVKHIAKLLPERFSAVSGPKNRVGRIFIDYLRN
GLGATTICAYAPRTREGLPVSVPIFREEIKELKGANTWTIHNIHQRLAELDSDPWADLAK
TRQTITAQMRTRVGMKG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggcactggacgagtacaaccgcaaacgcgacttcgatgccacgtccgagccc
tcgggcaacgaggcgaaaggcaggcgcggtgcgagcaaaaccaagacctcgacgaaggcc
gcgcatgccttgcagttctgcatccagaagcacgacgcgtcacgcctgcattacgatttc
cgcctggagctggacggcacgctgaaaagctgggcagtgcccaaaggcccgtccctggac
cccaaggccaagcgactggccgtccatgtcgaagaccacccgatcagttacgccacgttc
gaaggcagcatccctgaaggccattatggcgcaggcgatgtgattgtctgggaccgaggg
gtatggaagccgctgtccgaccctgctgaggcgtacaccaaaggcaggctgaaattcgag
ctgcaaggtgaaaagctcgcgggcgtgtggaacctggtcagaacccacatgcccggcaag
caggaacagtggtttttgatcaagcatcaggatgaattcgcccggcccgagagcgattac
gacgtcgtcaaagccgagccccacagcgtgttgagcgaacgcaccatcgttgagaaacag
gccgcgaaaaaatcgccgaaaaaatcctctgcaaaaactgctgaacccaaaccggcgtca
cccaaacccgtcgagaaagtcggcaaggcagcagcggctgaatcggcaacagcctcaaaa
aagtcgtcaggcaaaaccctgctggccaatgctgaacccgcagccatccccgacagcatc
aagccggagctggcgacgctggtggactctgcccccgaaggcgattggcgctacgagatc
aagtttgacggctaccgggtcatggccaggatcaacgacggcaaggtccagttgttcacc
cgcaacggccatgactggacccacaaactgcctcgtcaggccgaggcgctggccagcctg
gacttggagtccgcctggctggatggtgaaatggtggtggccaacgagcaaggggttccg
gatttccaatccctgcagaatgccttcgaggcgggcagcagcgacgccatcagctattac
ctgttcgacatgccctacctcaatggcatggacctgcgtcaggtcccggtggaacaacgc
cgagccgcactggccaaagtgctggagcgcagcgaagaccctgtgctgcgcttttccgag
gactttgccgaaacccctgatgccctgttgaacaccgcctgccagatgaagatggaaggc
ttgatcggcaagcggacgggcagcgcttacgtgtcccggcgcagtggcgactggatcaag
cttaaatgcaaacgtcggcaggaattcgtggtagtcgggttcaccgagcccaaaggcgca
cgcagcaagtttggcgccctgctgctgggtttgcatgatgccgacagcggcgagctgcgc
tatgcgggcaaggtcggcaccggcttcaacgaagccaccttgagcagcatccatcagcaa
ttgacgccgctggaggtcaaaaaacctgcggtgatcaacccgcccaccgggtttgaagcc
aagggcgtgcactggctcaaaccgcagctgctggccgaagtggcctttgctgaaatcacc
caggacggctcggtgcgccatgcggtgttccacggcctgcgcaccgacaagccagccagg
tcgatcaccgaggagcgccccgctactcccgccaggcagaaaaaaacagcaagcaaaacc
gctgcacactcagccaaagcgaaaaccacggcggccgaagcagaggctcagcccaaaccg
gagcccaaaccgaaacccaagtccaacgccaagcccaaagctgaagaaaccaagactacg
gagcccgcgctgacgggcaaggtgcggctcacccacccggaacggatcatcgacccggtc
agcggcgccaccaagcgtgatctggcggattactacattcgtatctcagagtggttgctg
ccacagctgaagaaccggcccgtagccctggtccgtgcaccggaaggcatcaccggcgag
ctattctttcagaaaaacgcagatcgcctgtcgattcccggcatcgaaaccatgggcaag
gaatacaccgggcatccgatgatgctgatcaataacctcgaagcgctgattggcgcggtg
cagatgagcactatcgaactgcacacctggaatgccgtgtccaaagaccttgaacggccg
gaccgattcatcctcgaccttgacccggacccggctctgccctggaaaagcatggtcgaa
gccacgcagctgaccctcaccgtgcttgacgagctgggcttgaagtcattcctcaagacc
agcggcggcaagggcattcacatcgtcgtgccgttgacccccaaggccgactgggatgcg
gtaaaggacttcagccatgcgatcgtcaaacacattgccaagctactgcccgaacggttt
tcagcggtgtcaggccccaagaatcgagtcggccggattttcatcgactacctgcgcaac
ggtttgggtgctaccacgatctgcgcctacgcgccccgcacccgtgaaggcctgcccgtg
tcggtgccgatctttcgagaggaaatcaaggaactcaaaggcgccaacacctggaccatt
cacaacatccaccagcgcttggcagagctggacagcgacccctgggcagacctggcaaaa
acccgacagaccatcaccgcccagatgcgcacgcgggtgggcatgaagggttga

DBGET integrated database retrieval system