KEGG   Paucimonas lemoignei: NCTC10937_02795Help
Entry
NCTC10937_02795   CDS       T05492                                 

Gene name
treS
Definition
(GenBank) Alpha amylase, catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
plg  Paucimonas lemoignei
Pathway
plg00500  Starch and sucrose metabolism
plg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCTC10937_02795 (treS)
Enzymes [BR:plg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NCTC10937_02795 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     NCTC10937_02795 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: SQF98662
UniProt: A0A2X4CYJ8
LinkDB All DBs
Position
1:complement(3133332..3136655)
Genome map
AA seq 1107 aa AA seqDB search
MAKKPKSAAFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLISKLDYIAELGVNTIW
LLPFYPSPRRDDGYDIADYRGVHSDYGTMSDAKKFIAEAHKRGLRVITELVINHTSDQHP
WFQKARAAKKGSKARDFYVWSDTDHKYDGTRIIFLDTEKSNWTWDPVAEQYFWHRFYSHQ
PDLNFDNPQVMEAVLEVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHAVLKKIRA
EIDTNYPDRMLLAEANQWPEDTQLYFGDTKGNDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRRRL
APLVQRDRRRVELLNSMLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPLYGFASVNVETQHNDPHSLLNWNRRMLAVRKQQKAFGRGVLKM
LSPSNRRILAYTREYTGPDGHTEIILCVANVSSASQAAELELSNYAGMVPVEMLGGSAFP
PIGQLNYLLTLPPYGFYWFLLASENQMPSWHVEPAQSMPDFPTMVLKKRLEELLDEPLRS
TMEQNSLALYLPKRRWFASKDQAIDKVHIAYAVRFGDAANPVLLSEIEVTTGGQTARYQL
PFGLLGEDDISSALPQQLALARVRRGRQVGLITDAFTLETFIRAVVHGMQVQTVVPSDDG
ELRFEHTSFLDPLGLSNESEVRYLSAEQSNSSVVVGGSLVLKMLRRVSPGVHPELEMGAF
LTNAGYQHISPLLGSVVRVGNDGEHNLLMIAQGYLSNQGDAWEWTQNNLERAVRDEMSHG
ISGQEQHYNALLELADFAANLGLRLGEMHKVLAASTDNPDFAVEVTSAKDSQASGKSVAE
QMDYALQLLEQNKASLEAVDQKLVNDLLANRKKVLAHVQALAKRSVGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARSVQERRAKYSPFKDVSGVLRSFDYAAAMAVRSAQSVDTSP
EASAARRRVADTYLSQARAAFIEGYRSATADIAHAWKDAKGESAALELFTLEKTAYEVVY
EARNRPGWLAVPLQGLRGLLNLSDGES
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaagagcgcggcattcatcaaggacccgctctggtacaaggatgca
gtgatttatcaggtgcacgtgaagtcgttcttcgattcgaacaacgacggcatcggtgac
tttcccggcctgatttcaaaactcgactacatcgcggagctgggcgtcaacaccatctgg
ctgctgccgttctacccgtcaccacggcgtgatgatggttacgacattgccgactatcgc
ggggtacacagcgattacgggaccatgtccgatgccaagaaattcatcgccgaggcccat
aagcgtggtttgcgggtgatcactgaactggtcatcaaccacacctcggatcagcacccc
tggttccagaaagcaagggcggcgaagaagggctccaaggcccgggatttctatgtgtgg
tccgacaccgaccacaagtacgacggcacgcggatcatctttctcgacaccgagaagtcc
aactggacctgggacccggtggcggagcagtacttctggcaccgtttctattcccaccag
cctgacctgaacttcgataacccgcaggtcatggaagcagtgctggaggtgatgcgttat
tggctggacatgggcatcgacggcctgcgtctggatgcgattccgtacttgattgagcgc
gatggcaccaacaacgagaacctgcccgaaacccacgcggtactcaaaaagatccgcgcg
gaaatcgataccaactaccccgaccgcatgctgctggccgaggccaatcagtggccggaa
gacacgcaactgtatttcggtgacaccaaaggcaacgacggcgatgaatgccacatggcg
ttccacttcccgttgatgccgcgcatgtacatggcgctggctcaggaagatcgcttcccg
atcaccgacatcctgcgtcagaccccggaaatcccggcgaactgccagtgggcgatcttc
ctgcgcaaccacgatgagctgactctggaaatggtcactgatcgcgagcgcgattacctg
tggaattactacgccgccgatcgtcgcgcccgcatcaatctgggcattcgccgtcgtctg
gcgccgctggtgcagcgtgatcgtcgtcgggtcgagttgctcaacagcatgctgctctcc
atgccgggcacgccgaccctgtattacggtgacgaaatcggcatgggcgacaatatttac
ctgggcgaccgcgacggtgtgcgcacccccatgcagtggtccatcgaccgcaacggcggt
ttctcccgtgccgacccggccagcctggtgcttccgccgatcatggacccgctgtatggc
tttgcgtcggtcaacgttgaaacccagcacaatgatccgcattccctgcttaactggaac
cggcgcatgttggcagtgcgtaagcagcagaaagcctttgggcgtggcgtattgaagatg
ctgtcgcccagcaatcgccggattctggcctatacccgtgagtacaccggacccgatggg
cacaccgagatcattctctgcgtggccaacgtctccagtgcctcgcaggctgccgagctt
gagctgtccaattatgccggcatggttccggtagagatgctcggtggcagtgcattcccg
cccatagggcagctgaattacctgctgacattgccgccctatggtttctattggttcctg
cttgcgtcggaaaaccagatgcccagctggcatgtggaacccgcgcagagcatgccggac
ttcccgaccatggttttgaaaaaacgcctcgaagaactgctcgatgaaccactgcgcagc
accatggagcaaaactccctggcgctgtatctgcccaagcgtcgctggtttgcgtccaag
gaccaggccatcgacaaggtgcacatcgcctacgcggtacgtttcggcgatgccgcgaac
cctgtgttgctcagcgagatcgaagtcaccaccggcggccagacggctcgctaccagttg
ccgttcggcctgctaggcgaggacgacatcagcagcgccttgcctcaacaactggctttg
gcgcgggtgcgccgtggtcgtcaggtgggtttgattactgacgcgtttaccctggaaacc
ttcatccgtgccgtcgtgcatggcatgcaggtgcaaaccgtagtgccgagcgacgacggc
gagttgcgctttgaacacacgtcgttcctcgatccgttgggcctcagcaatgagtccgaa
gtgcgctacctgtctgccgagcagtccaacagttcggtggtggtgggcggcagtctggtg
ctcaagatgctgcgccgggtcagccccggtgttcaccctgaactggagatgggcgcattc
ctcaccaacgccggctatcaacatatttcgccgctgctggggtctgtggtccgtgtcggt
aacgacggcgagcacaacctgctgatgattgcccagggttacctgagcaatcagggcgat
gcatgggagtggactcagaacaacctggagcgcgcggtgcgtgatgagatgtcccacggg
atatcgggtcaggagcagcattacaacgccttgctggagctggcggacttcgccgccaac
ctcggcctgcgcctgggcgagatgcacaaggtgctcgcggcttcaacggataacccggat
tttgccgtcgaagtcaccagcgccaaagacagccaggcgtccggcaagagcgttgccgag
cagatggactacgccctgcagttgctggaacagaacaaggcgtcactggaggcggttgac
cagaaactggtcaacgacctgctggccaatcgcaagaaggtactggcccatgtgcaggcc
ctcgccaagcgttcggtcggtggtttgcgcatcagggttcacggtgatctgcacctgggc
caggtattggtggtcaaaggcgatgcttacctgatcgacttcgaaggcgaaccggctcgg
tcggttcaggaacgtcgtgccaaatacagcccgttcaaggatgtcagcggtgtgctgcgc
tcgttcgactacgctgcggccatggccgtgcgcagcgcacaaagcgtggacacctcgccg
gaggccagcgccgcacggcgtcgggtcgccgatacgtatttaagccaggcccgtgcagcc
ttcattgagggctatcgctcggccacggccgacattgctcacgcctggaaagacgcaaag
ggtgaaagcgctgcgctggaattatttaccctggaaaaaactgcttatgaagtagtctac
gaagccagaaaccgcccgggctggttagccgtgccgttgcaagggctgcgtgggctgctg
aacctgtctgatggagagtcttga

DBGET integrated database retrieval system