KEGG   Paucimonas lemoignei: NCTC10937_03165Help
Entry
NCTC10937_03165   CDS       T05492                                 

Gene name
proC_2
Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
plg  Paucimonas lemoignei
Pathway
plg00330  Arginine and proline metabolism
plg01100  Metabolic pathways
plg01110  Biosynthesis of secondary metabolites
plg01130  Biosynthesis of antibiotics
plg01230  Biosynthesis of amino acids
Module
plg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NCTC10937_03165 (proC_2)
Enzymes [BR:plg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     NCTC10937_03165 (proC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NmrA
Motif
Other DBs
NCBI-ProteinID: SQF99028
UniProt: A0A2X4AIG4
LinkDB All DBs
Position
1:complement(3520319..3521098)
Genome map
AA seq 259 aa AA seqDB search
MQPETIGIIGGTGWLGGAIAQALIDTSFISADQLSLSNRSGVHPLAATGVQLVKDNQQLV
AACSTIMLAVRPEQFDTLGIDAQGKHVISLMAGVPASKIRAATGASVVIRAMPNASVGIG
RSFTPWHCGDPISQTLAAYIQRLFETVGTAARVPTEDCVDYLSALSGTGPAFPALLMTAL
TRQAVAAGVPDDIAVLAAKGVVVDASRLLETADPQQLIDALVGYRGVTAAALQSLMDEDF
EGRIGRAVQAGADVARKGM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcaacctgaaacgatcggcatcatcggtggaaccggctggctgggaggcgctatcgct
caggcgctgatcgacacgtcgttcatttcggctgatcaattgtctttgtcgaaccggtca
ggggttcatcccttggcggctaccggcgtgcagttggttaaagataaccagcagttggta
gcggcctgcagcaccatcatgctcgccgtacgcccagagcagttcgatacgctgggtatc
gatgcacaagggaaacatgtgatctctctcatggctggcgtgcctgcctcaaaaatcaga
gctgccacgggtgcctcagtggtcatccgtgcaatgcccaatgcgagcgtgggtattggc
cgatcctttacgccctggcattgcggcgacccgatttcgcagacgctggcggcgtacata
caacggctctttgaaaccgtgggcactgcggcccgcgtccccactgaagactgcgtcgac
tatctgagtgcgttgtcaggaacaggtccggcctttccagcgttattgatgacggcactg
acaaggcaagcagtggccgccggggtgccagacgatattgcggtactggcagccaagggt
gtggtggtcgacgccagcaggctgctggagaccgctgacccgcagcagttgatcgatgcg
ctggtcgggtacaggggcgtgactgccgccgcgcttcaatcgcttatggatgaagacttc
gagggccgtatcggccgggctgttcaggctggcgctgacgtggctcgcaaagggatgtga

DBGET integrated database retrieval system