KEGG   Paucimonas lemoignei: NCTC10937_03289Help
Entry
NCTC10937_03289   CDS       T05492                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
plg  Paucimonas lemoignei
Pathway
plg00020  Citrate cycle (TCA cycle)
plg00310  Lysine degradation
plg00380  Tryptophan metabolism
plg01100  Metabolic pathways
plg01110  Biosynthesis of secondary metabolites
plg01120  Microbial metabolism in diverse environments
plg01130  Biosynthesis of antibiotics
plg01200  Carbon metabolism
Module
plg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCTC10937_03289 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NCTC10937_03289 (sucB)
   00380 Tryptophan metabolism
    NCTC10937_03289 (sucB)
Enzymes [BR:plg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NCTC10937_03289 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: SQF99151
UniProt: A0A2X4CVU5
LinkDB All DBs
Position
1:complement(3646435..3647664)
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPSFPESVADGTISKWHKQPGEAVKRDELLVDIETDKVVLEVLAEADGVLASIV
KGEGEIVLSNELIATLDAGATASAAPAAAASAPAAAPAQAAAPAAAGDEDSVAAPAARKL
AEENGINLASVKGTGKDGRVTKEDVVAAVEAKKSAPAAAPAAKPAAAAAPVIAAGDRTEK
RVPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSNNGVRLGFMS
FFVKATTEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEQMSLAEIE
GGIAAFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPM
AVNGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccctctttcccggaatcagttgccgacggcaccatttcc
aagtggcacaaacagccgggcgaggcggtaaaacgtgacgagctgctggtcgacatcgag
accgacaaagtcgtcctcgaagtactggccgaagctgacggcgtgctggcatcgatcgtg
aagggcgagggcgaaatcgtcctgtccaacgaactgatcgcaactctggatgcaggtgct
accgcatctgctgctccagcggctgccgcttcggcacctgctgcggcaccggctcaggca
gctgctcctgccgccgctggcgacgaagattcggttgctgcgcctgctgctcgcaagctg
gctgaagaaaacggcatcaacctggccagcgtcaaaggcactggtaaagatggccgcgtg
accaaggaagacgtggttgctgccgttgaagcgaagaaatccgctccagccgctgcacct
gctgccaagcctgccgctgccgccgctcctgttatcgccgcaggcgatcgcaccgagaag
cgcgtaccgatgactcgtgtacgtgccaccgtggccaagcgtctggttgaagctcagtcg
aacatggcgatgctgaccacgttcaacgaagtggacatgaccgaagtcatggccctgcgc
tcgaagtacaaggacctgttcgagaagtccaacaacggcgtacgcctgggcttcatgtcg
ttcttcgtcaaggcaaccaccgaagcgctgaaacgcttcccggctgtcaacgcctcgatc
gacggttctgacatcgtttaccacggctacgctgacgtgggcgttgcggtttccagcgat
cgtggtctggtggttccggttctgcgtaacgcagagcagatgagcctggctgaaatcgaa
ggcggcatcgctgctttcggcaagaaagcccgtgacggcaagctgtccattgacgagatg
actggtggtaccttcaccatcacgaacggtggtaccttcggttcgatgatgtcgacgccg
atcgttaacccgccacaagcagccatcctgggtatgcacaacatcatccagcgcccgatg
gcggtcaacggtcaggtggttatccgtccgatgatgtacctggctctgtcctacgatcac
cgtctgatcgatggtaaagaagctgtgactttcctggtgaccatcaagaacctgctggaa
gatccagctcgtctgctgctggatatctga

DBGET integrated database retrieval system