KEGG   Planctomyces sp. SH-PL62: VT85_02045Help
Entry
VT85_02045        CDS       T04401                                 

Gene name
ykoU
Definition
(GenBank) putative ATP-dependent DNA ligase YkoU
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plh  Planctomyces sp. SH-PL62
Brite
KEGG Orthology (KO) [BR:plh00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    VT85_02045 (ykoU)
Enzymes [BR:plh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VT85_02045 (ykoU)
DNA repair and recombination proteins [BR:plh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VT85_02045 (ykoU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AMV36195
UniProt: A0A142YAI4
LinkDB All DBs
Position
complement(536597..538051)
Genome map
AA seq 484 aa AA seqDB search
MPLEEYNARRDFTRTREPAGTRGEEHRRPIFVVQEHHASVHHFDFRLEADGVLKSWSVPK
GPSLDPSAKRLAVQVEDHPLSYATFEGTIPKGQYGGGTVAIWDQGTYESLMEDQPEPKSV
SEAIEDGRLEFVMHGERLRGKFNLVRMKWGERKPQWLLMKSNDEFAERGTEPESGPRPKR
KSKPKRAESARPEPSTEAPEAVNLTHPGRIVYPDAGLTKKDVFAYYQKVAGRLLPFLKDR
PITLERLPDGLAGSAHFWQKNTPASYPGWIPRVELQTERGKPVRYALVNDEPTLLYLVNQ
GTLTFHVWASRVGDLDRPDFVLFDLDPGEASFADVVSVARAVKGELDELGVESFVKTSGK
TGLHVLTPWTRKTDFDEARAWALELAEKVAGGMPERATVEIRKAKRGGRVYIDVLQNARG
HHAVPPYVLRATPGATISTPLDWKEVASKLDPAAFTAKKVLARLRKVDPFAGLVESFGEQ
AAER
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggaagaatacaacgccaggcgagacttcaccaggacccgagagccggccggg
acaaggggcgaggagcaccggcggccgatcttcgtcgtccaggagcaccacgcctcggtc
caccacttcgacttccgcctggaggccgacggcgtgctgaagagctggtcggtgcccaag
gggccgtcgctcgacccctcggcgaagcggctggccgtccaggtggaggatcaccccctc
agctacgccacgttcgaggggacgattcccaagggacagtacggcggcggcacggtcgcc
atctgggaccagggcacctatgagagcctgatggaagaccagcccgagccgaagtccgtc
tccgaagcgatcgaggacggccggctcgagttcgtcatgcacggcgaacggctcaggggg
aaattcaacctggtccgcatgaaatggggcgaacgcaagccccaatggctgctgatgaag
tcgaacgacgagttcgccgagcgggggaccgaacccgagtccgggccgcgaccgaaacgg
aagtcgaagccgaagcgggccgagtccgcccggcccgagccgtcgaccgaagcgccggag
gcggtcaatctgacgcaccccggccggatcgtctatcccgacgccgggctcacgaagaag
gacgtcttcgcttactatcagaaggtcgcggggcgcctcctgccgtttttgaaggaccgg
cccatcaccctcgaacggctgccggacggcctcgccggatccgcccatttctggcagaag
aacacgcccgcttcctaccccggctggattccgcgcgtcgagctccagactgagcgcggc
aagccggtccgctacgcgctggtcaacgacgagccgacgctcctctatctcgtgaaccag
gggacgctgaccttccacgtctgggcctcgcgcgtcggcgacctcgaccggccggacttc
gtgctcttcgatctcgatccgggcgaggcttctttcgccgacgtcgtctcggtggccagg
gcggtcaagggggagctggacgaactgggcgtcgagtcgttcgtgaagacctcgggcaag
accggtctccacgtcctgaccccctggacccgcaagacggacttcgacgaggcgagggcc
tgggcgctcgagctggccgagaaggtggccggcgggatgcccgagcgggcgaccgtcgag
atccgcaaggcgaagcgcgggggacgggtctacatcgacgtcctgcagaacgcgcgaggc
catcacgccgtccccccctacgtcctgcgggcgacgccgggcgcgacgatctccacgccg
ctcgactggaaggaggtcgcgagcaagctcgacccggccgcgttcacggcgaagaaggtc
ctcgccaggctgcgcaaggtcgaccccttcgcggggctcgtcgagagcttcggcgagcag
gcggcggagcgttga

DBGET integrated database retrieval system