KEGG   Planctomyces sp. SH-PL62: VT85_12590Help
Entry
VT85_12590        CDS       T04401                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
plh  Planctomyces sp. SH-PL62
Pathway
plh03030  DNA replication
plh03410  Base excision repair
plh03420  Nucleotide excision repair
plh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:plh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VT85_12590
   03410 Base excision repair
    VT85_12590
   03420 Nucleotide excision repair
    VT85_12590
   03430 Mismatch repair
    VT85_12590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:plh03032]
    VT85_12590
   03400 DNA repair and recombination proteins [BR:plh03400]
    VT85_12590
Enzymes [BR:plh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VT85_12590
    6.5.1.6  DNA ligase (ATP or NAD+)
     VT85_12590
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VT85_12590
DNA replication proteins [BR:plh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VT85_12590
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VT85_12590
DNA repair and recombination proteins [BR:plh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VT85_12590
   NER (nucleotide excision repair)
    Other NER factors
     VT85_12590
   MMR (mismatch exicision repair)
    Other MMR factors
     VT85_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Phage_tail_X
Motif
Other DBs
NCBI-ProteinID: AMV38271
UniProt: A0A142YGA2
LinkDB All DBs
Position
3214998..3216596
Genome map
AA seq 532 aa AA seqDB search
MRDFARLYATLDETTRTTEKVEALTRYFEQAPPADAAWAVYFLIGRKPKQVVPSRKLREW
AAREAGVADWLFQESYDAVGDVAETVALLLPPSKRSTDLPLAEWVENRLLPLRGADEADQ
RAALLDAWRAMDRPQRFVWNKLISGGFRVGVSQQLVTRALAKVGGIEPAVVAHRLMGDWE
PDARFLTRLLAPDATDADHSRPYPFCLAHGIEGEPEALGPVEDWQAEWKWDGIRCQLIRR
GGDTFLWSRGEELVTDRYPELATLGAFLPEGTAIDGEILPYRDGVPLPFAQLQRRIGRKT
VGKTILAEIPVVLIAYDLLEFEGRDLRAEPFEVRRARLAEVVDRVAQPGRLILSPAVVAT
TWAGLAAAREESRSRQAEGLMLKRIGSPYHVGRKRGDWWKWKVDPFTVDAVLTAAQRGSG
KRASLYTDYTFSVWDDDRRLVPFAKAYSGLTDAEIARVDAFIRRNMVEKFGPVRTVKPEL
VFELAFEGIQRSPRHKSGLAVRFPRILRWRQDKPADEADTLDSIRGMLPPSP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagggatttcgcgcggctctacgcgacgctcgacgagacgacccggaccaccgagaag
gtcgaggccctgacccgctacttcgagcaggccccgccggccgacgccgcctgggcggtc
tacttcctgatcggccggaagccgaagcaggtggtcccgtcccggaagctccgcgaatgg
gcggcgcgcgaggcgggcgtggccgactggctgttccaggagtcgtacgacgccgtgggg
gacgtggccgagaccgtggccctgctgctccccccctcgaaacggtccaccgacctcccc
ctggccgagtgggtcgagaatcggctcctcccgctgcggggggccgacgaggccgaccag
cgggccgccctgctcgacgcctggcgggcgatggaccgcccccagcggttcgtctggaac
aagctgatcagcggcgggttccgggtcggcgtctcgcagcaactggtgacccgcgcgctg
gcgaaggtgggggggatcgagccggccgtggtcgcccatcgcctgatgggggattgggag
cccgacgcccggttcctcacgcggctgctcgccccggacgccaccgacgcggaccacagc
cgcccctatccgttctgcctggcccacgggatcgaaggagagcccgaggccctcggcccc
gtcgaggactggcaggccgagtggaagtgggacggcatccgttgccagttgatccgccgg
ggtggcgacacgttcctctggtctcgcggcgaggagctggtgaccgaccgctatcccgag
ctggcgacccttggcgcgttcctccccgaagggacggcgatcgacggcgagatcctgccg
tatcgcgacggcgtccccctgccgttcgcgcagctccagcggcggatcggccggaagacg
gtaggcaagacgatcctggccgagatccccgtcgtcctgatcgcctacgacctcctcgaa
ttcgagggccgcgacctccgcgccgaaccgttcgaggtccgccgggcgaggctggccgag
gtggtcgaccgggtcgcccagcccggccgcctgatcctctcgccggcggtcgtcgcgacc
acgtgggccgggctcgccgccgcccgcgaggagtctcggtcgcgacaggccgaggggctg
atgctcaagcggatcggctcgccgtaccacgtcggccgcaagcggggcgactggtggaag
tggaaggtcgacccgttcaccgtcgacgccgtgctcaccgcggcgcagcgggggagcggc
aagcgggccagcctctacaccgactacacgttcagcgtctgggacgacgaccgccgcctg
gtcccgttcgccaaggcctactccgggctcaccgacgccgagatcgcccgggtcgacgcc
ttcatccgccgcaacatggtggagaagttcggcccggtccgcaccgtcaagccggaactc
gtcttcgagctggccttcgaggggatccagcgctcgccccgccacaagtcggggctcgcc
gtccgcttccctcggatcctccgctggcgtcaggacaagcccgcggacgaggccgacacg
ctcgactccatccggggcatgctccccccctcgccctga

DBGET integrated database retrieval system