KEGG   Purpureocillium lilacinum: VFPFJ_00022Help
Entry
VFPFJ_00022       CDS       T05029                                 

Definition
(RefSeq) DNA ligase I, ATP-dependent (dnl1)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
plj  Purpureocillium lilacinum
Pathway
plj03030  DNA replication
plj03410  Base excision repair
plj03420  Nucleotide excision repair
plj03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:plj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VFPFJ_00022
   03410 Base excision repair
    VFPFJ_00022
   03420 Nucleotide excision repair
    VFPFJ_00022
   03430 Mismatch repair
    VFPFJ_00022
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:plj03032]
    VFPFJ_00022
   03400 DNA repair and recombination proteins [BR:plj03400]
    VFPFJ_00022
Enzymes [BR:plj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VFPFJ_00022
    6.5.1.6  DNA ligase (ATP or NAD+)
     VFPFJ_00022
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VFPFJ_00022
DNA replication proteins [BR:plj03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VFPFJ_00022
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VFPFJ_00022
DNA repair and recombination proteins [BR:plj03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VFPFJ_00022
   NER (nucleotide excision repair)
    Other NER factors
     VFPFJ_00022
   MMR (mismatch excision repair)
    Other MMR factors
     VFPFJ_00022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-GeneID: 28882157
NCBI-ProteinID: XP_018182633
UniProt: A0A179HV69
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MFQVWLATNSISPAYISLDRSLKAICDKYGDAGDVAFEAKKKQSFTFRKPKPLSIKGVYQ
SLVKIATTQGQGSNEVKQRIVDRLLQDARGGEESRFIVRTLCQRLRIGAVKTTMLVALSR
AFLLSRPGEADFPLQSAPELSKLKREELAEVWGKAEEIVKACFARHPNYNDLIPVLLQIG
VTEELLVCCGLTLHIPLRPMLGSITRDLSEMLTKLQGRDFACEFKYDGQRAQVHCDEKAN
VSIFSRHLDLVTDKYPDLVELVPKIRSEGVSSFIMDGELVAVDRGTGELKKYQALTNRAR
KDVDIGSITIDVCLFSFDLMYLNGQPLLDRPFRERRKLLRTLFTEVPHHFTWVKSLDATS
VDSEAVLDFFKSAIESKCEGIMVKILDNLRDVPYADYAPEQPQPLKLSEKLSTPNSKPKL
KQKSKNGTAVSGEEGKIKSRRKPLLATYEPDKRLDSWLKVKKDYNSSFDTLDLIPIAGWH
GQGRKAKWWSPILLAVPNEETGMFEAVCKCISGFTDAFCQANKQFYDNGDESGEPKNVRF
QKPSYIEYNGPGPDVWFEPQEVWEVAFADITLSPTYTAAIGLVSDERGLSLRFPRFLKKR
EDKGIEEASTNEFLAGLWRKQEAKAVTERDSKAAGEEEAGEV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggtctggcttgcaaccaactcgatatcaccagcctacatttctcttgatcga
tcgctcaaggccatttgcgacaagtacggcgatgctggtgatgttgcgtttgaggcaaag
aagaagcaaagcttcacctttcgaaagcccaagcctctgtctatcaaaggggtttaccaa
tcattggtcaagattgctacaactcaaggccagggcagcaacgaagtgaagcaacgaatt
gtcgatcgactgctgcaagatgctcgaggaggcgaagagagccgattcatagtgcgaact
ctttgccagcgtctaagaataggcgccgtcaagacgacaatgcttgtagccctatctcga
gcctttctgttatcgcggcccggagaggccgacttccccttgcaatcggcaccagaactg
tccaagctcaagagggaagaattggccgaagtatggggcaaggccgaagagatcgtcaag
gcatgctttgcaagacatcccaactacaatgacctgataccagttcttctccaaataggt
gtcacggaagagctgctggtgtgttgcggcttgactctacacatcccgctgcggcctatg
ctgggtagtatcacccgcgatttgtcagagatgttgaccaagttgcaaggccgggacttt
gcatgtgagttcaaatatgacggccagagagcacaagtccactgcgatgagaaggcgaat
gtgtccatcttctcacgccacctggatctggtgacggacaagtaccctgaccttgtggag
ctggtgcccaagattcgcagcgaaggcgtgagcagcttcatcatggatggggaacttgtg
gctgtcgaccgaggcacaggcgagctcaagaaataccaggcgttgacgaaccgcgctagg
aaggatgtggacatcggaagcatcaccatagatgtgtgcctgttttcgtttgatctgatg
tacctgaacggacagccactcctcgatcgaccgttccgagagcgtcgaaaacttctgcga
acactattcacagaagtgcctcaccactttacatgggtcaagagccttgacgcaacatcc
gtagattccgaggccgtgttggacttcttcaagtcagccatcgagagcaagtgcgaaggg
attatggtcaagatcctggacaacttacgcgacgtgccatatgccgactacgccccggag
caaccacaaccactcaagttatccgagaaactctcgacaccaaattcaaagccaaagttg
aagcagaaatcgaagaacgggacggctgtcagtggtgaagagggcaaaatcaagtctcga
aggaaaccgctcttagccacgtacgagccggacaagcgactggactcgtggctcaaggtc
aagaaagactacaactcaagtttcgataccctggacttgatccctatagccggctggcat
ggacaaggccgcaaggcgaagtggtggtcaccgatcttgctggcggtgcccaatgaggag
acgggaatgttcgaggcggtgtgcaaatgcatatctggcttcaccgacgcgttttgccag
gcgaataagcagttttacgacaatggcgacgagagcggcgagccgaaaaacgttcggttt
caaaagccgagttacatagaatacaacggtccaggcccggatgtgtggtttgaaccgcaa
gaagtctgggaggtggcgtttgcagacattactctgagcccgacttatacggcggcgatt
ggcctggtgagcgacgagagaggactgagcctgcggtttccacgatttttgaagaagcga
gaggacaagggcattgaggaggccagcaccaacgagtttctagccgggctttggaggaag
caggaggcaaaggccgtgaccgagagagattcaaaggcagctggtgaggaagaggctggg
gaggtgtga

DBGET integrated database retrieval system