KEGG   Purpureocillium lilacinum: VFPFJ_00181Help
Entry
VFPFJ_00181       CDS       T05029                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
plj  Purpureocillium lilacinum
Pathway
plj04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:plj00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    VFPFJ_00181
Enzymes [BR:plj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VFPFJ_00181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 28882316
NCBI-ProteinID: XP_018182792
UniProt: A0A179HXL6
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSKVTGNVIFEQESESAPTKVTWDITGNDANAKRGFHIHTFGDNTNGCTS
AGPHFNPHGKKHGAPTDEERHVGDLGNVETDAQGNAKGSVSDKHIKLIGPHSIIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggccgtcgctgtcctccgtggtgactccaaggtcacgggtaacgtcatcttc
gagcaggagtccgagtccgctcccaccaaggtcacctgggacatcacgggcaacgacgcc
aacgcgaagcgcggcttccacatccacacctttggcgacaacaccaacggctgcacctct
gccggccctcacttcaacccccacggcaagaagcacggtgctcccacggacgaggagcgt
cacgtcggcgacctcggcaacgtcgagaccgacgcccagggcaacgccaagggttccgtg
tctgacaagcacatcaagctcatcggcccccacagcatcatcggccgcaccgtcgtcgtc
cacgccggcaccgacgacctcggcaagggcggcaacgaggagtccctcaagactggcaac
gccggtccccgtcccgcctgcggcgtcattggcatctccaactag

DBGET integrated database retrieval system